Recombinant Human H1F0 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human H1F0 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-54 of Human H1F0 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
H1F0

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human H1F0 Protein

  • H1 histone family, member 0
  • H1.0, H1(0), H1-0
  • H10
  • H1FVMGC5241
  • Histone H1'
  • Histone H1(0)
  • histone H1.0

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H1 family. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-48588
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02576
Species: Hu, Rt, Mk
Applications: WB, Flow, ICC/IF
NBP2-06757
Species: Hu
NBP2-20154
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00000389-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
MAB4645
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-76471
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
H00003005-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for H1F0 Partial Recombinant Protein (H00003005-Q01) (0)

There are no publications for H1F0 Partial Recombinant Protein (H00003005-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for H1F0 Partial Recombinant Protein (H00003005-Q01) (0)

There are no reviews for H1F0 Partial Recombinant Protein (H00003005-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for H1F0 Partial Recombinant Protein (H00003005-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional H1F0 Products

Bioinformatics Tool for H1F0 Partial Recombinant Protein (H00003005-Q01)

Discover related pathways, diseases and genes to H1F0 Partial Recombinant Protein (H00003005-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for H1F0 Partial Recombinant Protein (H00003005-Q01)

Discover more about diseases related to H1F0 Partial Recombinant Protein (H00003005-Q01).
 

Pathways for H1F0 Partial Recombinant Protein (H00003005-Q01)

View related products by pathway.

PTMs for H1F0 Partial Recombinant Protein (H00003005-Q01)

Learn more about PTMs related to H1F0 Partial Recombinant Protein (H00003005-Q01).

Blogs on H1F0

There are no specific blogs for H1F0, but you can read our latest blog posts.

Customers Who Bought This Also Bought

H1F0 Antibody
NBP2-16772

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human H1F0 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol H1F0