GRK3 Recombinant Protein Antigen

Images

 
There are currently no images for GRK3 Protein (NBP1-90008PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GRK3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADRBK2.

Source: E. coli

Amino Acid Sequence: YEAVNADTDKIEARKRAKNKQLGHEEDYALGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQNLLTMEQILSVEETQIKDKKCILFRIKGGKQFVLQCESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPRS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GRK3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90008.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GRK3 Recombinant Protein Antigen

  • ADRBK2
  • adrenergic, beta, receptor kinase 2
  • BARK2
  • BARK2beta-adrenergic receptor kinase 2
  • Beta-ARK-2
  • EC 2.7.11
  • EC 2.7.11.15
  • G-protein-coupled receptor kinase 3
  • GRK3
  • GRK3Beta-ARK-2

Background

Heterotrimeric G protein-mediated signal transduction is a dynamically regulated process with the intensity of signal decreasing over time despite the continued presence of the agonist. This phenomenon, referred to as agonistmediated desensitization, involves phosphorylation of the receptor by two classes of enzymes. The first are the second essenger-regulated kinases such as c-AMP dependent protein kinase A and protein kinase C. The second are the G protein-coupled receptor kinases (GRKs). At least seven members of the GRK family have been identified. These include rhodopsin kinase, GRK 1; two forms of beta-adrenergic receptor kinase, GRK 2 (betaARK, betaARK1) and GRK 3 (betaARK2); IT-11 (GRK 4); GRK 5, GRK 6 and GRK 7.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4339
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF4539
Species: Hu, Mu, Rt
Applications: KO, WB
NBP2-41248
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NLS418
Species: Hu
Applications: IHC,  IHC-P
NLS2756
Species: Hu, Pm
Applications: ICC, IHC,  IHC-P
MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NLS1017
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC,  IHC-P
NLS2576
Species: Hu, Pm, Rt
Applications: IHC,  IHC-P
MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB

Publications for GRK3 Protein (NBP1-90008PEP) (0)

There are no publications for GRK3 Protein (NBP1-90008PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRK3 Protein (NBP1-90008PEP) (0)

There are no reviews for GRK3 Protein (NBP1-90008PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GRK3 Protein (NBP1-90008PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GRK3 Products

Research Areas for GRK3 Protein (NBP1-90008PEP)

Find related products by research area.

Blogs on GRK3.

"Freeze!" - Arrestin Antibodies Used in New Serotonin Syndrome Study
The beta-arrestin family regulate receptor binding of G-proteins, a group of seven transmembrane receptor proteins which includes the adrenergic, dopamine and serotonin receptors. Recently, arrestin antibodies were used in a study into Serotonin Syndr...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GRK3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GRK3