GPRC5C Recombinant Protein Antigen

Images

 
There are currently no images for GPRC5C Protein (NBP1-87159PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GPRC5C Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPRC5C.

Source: E.coli

Amino Acid Sequence: TSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQAATPPKDGKNSQVFRN

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GPRC5C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-87159.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for GPRC5C Recombinant Protein Antigen

  • G protein-coupled receptor, family C, group 5, member C
  • GPRC5C
  • MGC131820
  • RAIG3
  • RAIG-3G-protein coupled receptor family C group 5 member C
  • RAIG3orphan G-protein coupled receptor
  • retinoic acid responsive gene protein
  • Retinoic acid-induced gene 3 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89743
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IHC-FrFl
NLS2576
Species: Hu, Rt, Mk
Applications: IHC, IHC-P
H00134391-B01P
Species: Hu
Applications: WB, ELISA, Flow
NLS2756
Species: Hu, Mk
Applications: IHC, IHC-P, ICC
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NLS2272
Species: Hu, Mk, Pm
Applications: IHC, IHC-P
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NLS1017
Species: Hu, Mu, Bt, Bv, Ca, Eq
Applications: IHC, IHC-P
NBP1-87223
Species: Hu
Applications: IHC, IHC-P
NLS568
Species: Hu
Applications: IHC, IHC-P
MAB8200
Species: Hu, Mu
Applications: IHC
NBP2-16655
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB110-55498
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
NBP1-87159PEP
Species: Hu
Applications: AC

Publications for GPRC5C Protein (NBP1-87159PEP) (0)

There are no publications for GPRC5C Protein (NBP1-87159PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPRC5C Protein (NBP1-87159PEP) (0)

There are no reviews for GPRC5C Protein (NBP1-87159PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GPRC5C Protein (NBP1-87159PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional GPRC5C Products

Bioinformatics Tool for GPRC5C Protein (NBP1-87159PEP)

Discover related pathways, diseases and genes to GPRC5C Protein (NBP1-87159PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPRC5C Protein (NBP1-87159PEP)

Discover more about diseases related to GPRC5C Protein (NBP1-87159PEP).
 

Pathways for GPRC5C Protein (NBP1-87159PEP)

View related products by pathway.

Research Areas for GPRC5C Protein (NBP1-87159PEP)

Find related products by research area.

Blogs on GPRC5C

There are no specific blogs for GPRC5C, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GPRC5C Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GPRC5C