GPRC5C Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPRC5C. Source: E.coli
Amino Acid Sequence: TSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQAATPPKDGKNSQVFRN |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
GPRC5C |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This peptide is useful as a blocking peptide for NBP1-87159.Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.For further blocking peptide related information and a protocol, click here. |
Theoretical MW |
25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Alternate Names for GPRC5C Recombinant Protein Antigen
Background
GPRC5C is encoded by this gene is a member of the type 3 G protein-coupled receptor family. Members of this superfamily are characterized by a signature 7-transmembrane domain motif. The specific function of this protein is unknown; however, this protein may mediate the cellular effects of retinoic acid on the G protein signal transduction cascade. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, WB
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Pm, Pm
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Ca, Hu
Applications: IHC, IHC-Fr, IHC-P, WB
Publications for GPRC5C Protein (NBP1-87159PEP) (0)
There are no publications for GPRC5C Protein (NBP1-87159PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GPRC5C Protein (NBP1-87159PEP) (0)
There are no reviews for GPRC5C Protein (NBP1-87159PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for GPRC5C Protein (NBP1-87159PEP) (0)
Additional GPRC5C Products
Bioinformatics Tool for GPRC5C Protein (NBP1-87159PEP)
Discover related pathways, diseases and genes to GPRC5C Protein (NBP1-87159PEP). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for GPRC5C Protein (NBP1-87159PEP)
Discover more about diseases related to GPRC5C Protein (NBP1-87159PEP).
| | Pathways for GPRC5C Protein (NBP1-87159PEP)
View related products by pathway.
|
Research Areas for GPRC5C Protein (NBP1-87159PEP)
Find related products by research area.
|
Blogs on GPRC5C