GPR98 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

GPR98 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPR98.

  Source: E. coli

  Amino Acid Sequence: ESIIVSLVYTEGGSRILPSSDTVRVNILANDNVAGIVSFQTASRSVIGHEGEILQFHVIRTFPGRGNVTVNWKIIGQNLELNFANFSGQLFFPEGSLNTTLFVHLLDDNIPEEKEVYQVILYDVRTQGVPPAGIALLDAQGYAA

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: GPR98
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57048.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GPR98 Recombinant Protein Antigen

• FEB4
• G protein-coupled receptor 98
• MASS1
• USH2B
• USH2C
• VLGR1
• VLGR1b

Background

GPR98, also known as Very Large G Protein-Coupled Receptor-1 (VLGR1), is an Orphan-A GPCR with an unknown ligand. VLGR1 consists of three expressed isoforms. VLGR1 has a large ectodomain containing multiple CALX-beta repeats that resemble regulatory domains of sodium-calcium exchanger proteins. VLGR1b, which is the only form expressed in mouse, is apparently the largest known cell-surface protein with an ectodomain containing 35 CALX- repeats and a pentraxin homology domain. The MASS1 gene, which is a fragment of the very large G-protein-coupled receptor VLGR1, is mutated in the Frings mouse model of audiogenic epilepsy. VLGR1 has been reported to be widely expressed in normal solid tissues. ESTs have been isolated from human adrenal, brain, colon, eye, kidney, nerve, and testis libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: GPR98