GPR31 Antibody - BSA Free

Western Blot: GPR31 Antibody [NBP2-87524] - Host: Rabbit. Target Name: GPR31. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GPR31 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GPR31 Antibody - BSA Free (NBP2-87524) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR31. Peptide sequence: QKRLREPEKQPKLQRAQALVTLVVVLFALCFLPCFLARVLMHIFQNLGSC The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR31
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GPR31 Antibody - BSA Free

• 12-HETER
• bA517H2.2 (G protein-coupled receptor 31)
• G protein-coupled receptor 31
• GPR31
• HETER1
• probable G-protein coupled receptor 31

Background

GPR31 is an Orphan-A GPCR with an unknown ligand. GPR31 mRNA is expressed at low levels in several human cell lines of different cellular origins (Zingoni et al., 1997).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GPR31