![Western Blot: GPR111 Antibody [NBP3-09568] - Western blot analysis of GPR111 in Fetal Brain lysates. Antibody dilution at 1.0ug/ml](http://images.novusbio.com/fullsize/GPR111-Antibody-Western-Blot-NBP3-09568-img0001.jpg "Western Blot: GPR111 Antibody [NBP3-09568] - Western blot analysis of GPR111 in Fetal Brain lysates. Antibody dilution at 1.0ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | Novus Biologicals Rabbit GPR111 Antibody - BSA Free (NBP3-09568) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPR111 (NP_722581). Peptide sequence TESCRTLYQAASKSKEKVPARPHGVCDGVCTDYSQCTQPCPPDTQGNMGF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ADGRF2P |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 78 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Flow Cytometry EMR3 Antibody (908235) [Unconjugated]](https://images.novusbio.com/images2/EMR3_MAB8496_Flow_Cytometry_16807.jpg)
![Immunohistochemistry EMR3 Antibody (908235) [Unconjugated]](https://images.novusbio.com/images2/mab8496_human-emr3-mab-clone-908235-immunohistochemistry-2852021145344.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for GPR111 Antibody (NBP3-09568)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ADGRF2P |
![Western Blot GPR56 Antibody [Unconjugated]](https://images.novusbio.com/images2/GPR56_AF4634_Western_Blot_11569.jpg)
![Simple Western GPR56 Antibody [Unconjugated]](https://images.novusbio.com/images2/GPR56_AF4634_Simple_Western_22172.jpg)
![Flow Cytometry GPR56 Antibody [Unconjugated]](https://images.novusbio.com/images2/GPR56_AF4634_Flow_Cytometry_12104.jpg)
![Flow Cytometry GPR64 Antibody [Unconjugated]](https://images.novusbio.com/images2/GPR64_AF7977_Flow_Cytometry_22399.jpg)
![Western Blot GPR64 Antibody [Unconjugated]](https://images.novusbio.com/images2/GPR64_AF7977_Western_Blot_13069.jpg)
![Immunohistochemistry GPR64 Antibody [Unconjugated]](https://images.novusbio.com/images2/GPR64_AF7977_Immunohistochemistry_13077.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
