Recombinant Human GPR110 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human GPR110 GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 218 of Human GPR110 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MKVGVLWLISFFTFTDGHGGFLGKNDGIKTKKELIVNKKKHLGPVEEYQLLLQVTYRDSKEKRDLRNFLKLLKPPLLWSHGLIRIIRAKATTDCNSLNGVLQCTCEDSYTWFPPSCLDPQNCYLHTAGALPSCECHLNNLSQSVNFCERTKIWGTFKINERFTNDLLNSSSAIYSKYANGIEIQLKKAYERIQGFESVQVTQFRMSLLSPKLECNGTI

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
ADGRF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
51.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GPR110 GST (N-Term) Protein

  • FLJ22684
  • FLJ30646
  • G protein-coupled receptor 110
  • G protein-coupled receptor PGR19
  • GPCR36
  • GPR110
  • G-protein coupled receptor 110
  • G-protein coupled receptor KPG_012
  • G-protein coupled receptor PGR19
  • hGPCR36
  • KPG_012
  • PGR19
  • PGR19MGC125952
  • probable G-protein coupled receptor 110
  • seven transmembrane helix receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS1519
Species: Hu, Pm, Pm
Applications: IHC, IHC-P
AF4634
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready
AF5437
Species: Hu
Applications: WB
AF6494
Species: Hu
Applications: WB
AF4894
Species: Hu
Applications: WB, Neut
AF7977
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC
MAB8496
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-03561
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-87285
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC, IHC-P
AF4984
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
AF2950
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-67375
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-52193
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00266977-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for GPR110 Recombinant Protein (H00266977-P01) (0)

There are no publications for GPR110 Recombinant Protein (H00266977-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR110 Recombinant Protein (H00266977-P01) (0)

There are no reviews for GPR110 Recombinant Protein (H00266977-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPR110 Recombinant Protein (H00266977-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional GPR110 Products

Bioinformatics Tool for GPR110 Recombinant Protein (H00266977-P01)

Discover related pathways, diseases and genes to GPR110 Recombinant Protein (H00266977-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR110 Recombinant Protein (H00266977-P01)

Discover more about diseases related to GPR110 Recombinant Protein (H00266977-P01).
 

Pathways for GPR110 Recombinant Protein (H00266977-P01)

View related products by pathway.

PTMs for GPR110 Recombinant Protein (H00266977-P01)

Learn more about PTMs related to GPR110 Recombinant Protein (H00266977-P01).
 

Research Areas for GPR110 Recombinant Protein (H00266977-P01)

Find related products by research area.

Blogs on GPR110

There are no specific blogs for GPR110, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MUC4 Antibody
NBP1-52193

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GPR110 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ADGRF1