Recombinant Human GPR110 Protein

Images

 
There are currently no images for GPR110 Recombinant Protein (H00266977-G01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AP

Order Details

Recombinant Human GPR110 Protein Summary

Description
An untagged recombinant protein corresponding to the amino acid sequence of (NP_079324.2) for Human GPR110

Source: Wheat Germ

Amino Acid Sequence: MKVGVLWLISFFTFTDGHGGFLGKNDGIKTKKELIVNKKKHLGPVEEYQLLLQVTYRDSKEKRDLRNFLKLLKPPLLWSHGLIRIIRAKATTDCNSLNGVLQCTCEDSYTWFPPSCLDPQNCYLHTAGALPSCECHLNNLSQSVNFCERTKIWGTFKINERFTNDLLNSSSAIYSKYANGIEIQLKKAYERIQGFESVQVTQFRMSLLSPKLECNGTI

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
GPR110
Purity
>30% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
24.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
25 mM Tris-HCl pH8.0 in 2% glycerol.
Preservative
No Preservative
Purity
>30% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GPR110 Protein

  • FLJ22684
  • FLJ30646
  • G protein-coupled receptor 110
  • G protein-coupled receptor PGR19
  • GPCR36
  • GPR110
  • G-protein coupled receptor 110
  • G-protein coupled receptor KPG_012
  • G-protein coupled receptor PGR19
  • hGPCR36
  • KPG_012
  • PGR19
  • PGR19MGC125952
  • probable G-protein coupled receptor 110
  • seven transmembrane helix receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS1513
Species: Hu
Applications: IHC-P
AF4634
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready
NBP2-58896
Species: Hu
Applications: IHC, IHC-P
AF6494
Species: Hu
Applications: WB
NLS1663
Species: Hu
Applications: ELISA, IHC, IHC-P, ICC
NBP1-84906
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80918
Species: Hu
Applications: IHC, IHC-P
MAB8496
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-03561
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP1-87285
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83262
Species: Hu
Applications: IHC, IHC-P
NLS2034
Species: Hu
Applications: IHC, IHC-P
NLS1720
Species: Hu
Applications: IHC-P
NLS418
Species: Hu
Applications: IHC-P
AF4984
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
NBP1-82890
Species: Hu
Applications: IHC, IHC-P
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-13843
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52193
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for GPR110 Recombinant Protein (H00266977-G01) (0)

There are no publications for GPR110 Recombinant Protein (H00266977-G01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR110 Recombinant Protein (H00266977-G01) (0)

There are no reviews for GPR110 Recombinant Protein (H00266977-G01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for GPR110 Recombinant Protein (H00266977-G01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for GPR110 Recombinant Protein (H00266977-G01)

Discover related pathways, diseases and genes to GPR110 Recombinant Protein (H00266977-G01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR110 Recombinant Protein (H00266977-G01)

Discover more about diseases related to GPR110 Recombinant Protein (H00266977-G01).
 

Pathways for GPR110 Recombinant Protein (H00266977-G01)

View related products by pathway.

PTMs for GPR110 Recombinant Protein (H00266977-G01)

Learn more about PTMs related to GPR110 Recombinant Protein (H00266977-G01).
 

Research Areas for GPR110 Recombinant Protein (H00266977-G01)

Find related products by research area.

Blogs on GPR110

There are no specific blogs for GPR110, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MUC4 Antibody
NBP1-52193
GPR110 Antibody
NBP1-89700

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GPR110 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR110