GPR107 Antibody

Images

 
Western Blot: GPR107 Antibody [NBP2-82922] - Host: Rabbit. Target Name: GP107. Sample Type: Stomach Tumor lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPR107 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPR107. Peptide sequence: SKRSTVDSKAMGEKSFSVHNNGGAVSFQFFFNISTDDQEGLYSLYFHKCL The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (93%), Rabbit (93%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
GPR107
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPR107 Antibody

  • BA138E2.2
  • DKFZp667C222
  • FLJ16312
  • FLJ20998
  • FLJ22591
  • G protein-coupled receptor 107
  • GPR107
  • KIAA1624
  • KIAA1624GCDRP
  • Lung seven transmembrane receptor 1
  • LUSTR1
  • LUSTR1MGC126118
  • MGC15440
  • protein GPR107
  • RP11-88G17

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82812
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
AF4634
Species: Hu
Applications: WB, Simple Western, Flow, CyTOF-ready
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
NBP2-41194
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-03349
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
AF5414
Species: Hu
Applications: WB, Simple Western
NLS442
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS2756
Species: Hu, Pm
Applications: IHC, IHC-P, ICC
NBP2-82922
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb
Applications: WB

Publications for GPR107 Antibody (NBP2-82922) (0)

There are no publications for GPR107 Antibody (NBP2-82922).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR107 Antibody (NBP2-82922) (0)

There are no reviews for GPR107 Antibody (NBP2-82922). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GPR107 Antibody (NBP2-82922) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GPR107 Products

Bioinformatics Tool for GPR107 Antibody (NBP2-82922)

Discover related pathways, diseases and genes to GPR107 Antibody (NBP2-82922). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR107 Antibody (NBP2-82922)

Discover more about diseases related to GPR107 Antibody (NBP2-82922).

Research Areas for GPR107 Antibody (NBP2-82922)

Find related products by research area.

Blogs on GPR107

There are no specific blogs for GPR107, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR107 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR107