GPAA1 Recombinant Protein Antigen

Images

 
There are currently no images for GPAA1 Recombinant Protein Antigen (NBP3-17254PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GPAA1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPAA1

Source: E. coli

Amino Acid Sequence: MQSSPLQGRAGAIQAAVALELSSDVVTSLDVAVEGLNGQLPNLDLLNLFQTFCQKGGLLCTLQGKLQPEDWTSLDGPL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GPAA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17254.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GPAA1 Recombinant Protein Antigen

  • anchor attachment protein 1 (Gaa1p, yeast) homolog
  • GAA1 protein homolog
  • GAA1glycophosphatidylinositol anchor attachment 1
  • glycosylphosphatidylinositol anchor attachment protein 1 homolog (yeast)
  • GPAA1P anchor attachment protein 1 homolog (yeast)
  • GPAA1P anchor attachment protein 1 homolog
  • GPI anchor attachment protein 1
  • GPI transamidase subunit
  • hGAA1glycosylphosphatidylinositol anchor attachment 1 protein

Background

The GPAA1 gene codes for a post-translational glycosylphosphatidylinositol (GPI) anchor attachment 1 protein at the GPI transfer step but is not essential for GPI synthesis. This protein functions as a general mechanism to link proteins to the cell surface membrane and is coded before/during the formation of the carbonyl intermediate. Isoform 1 is 621 amino acids in length at 67 kDA while isoform 2 exists at 561 amino acids long at 61 kDA. GPAA1 participates in various metabolic pathways as well as post-translational protein modification through interactions with genes PRR13, ALPP, PIN1, EIF3E, and GRIK5. GPAA1 has been investigated regarding various diseases such as ataxia, hepatocellular carcinoma, and breast cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31564
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-01743
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-38142
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-89296
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-85856
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-05034
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
DR2A00
Species: Hu
Applications: ELISA

Publications for GPAA1 Recombinant Protein Antigen (NBP3-17254PEP) (0)

There are no publications for GPAA1 Recombinant Protein Antigen (NBP3-17254PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPAA1 Recombinant Protein Antigen (NBP3-17254PEP) (0)

There are no reviews for GPAA1 Recombinant Protein Antigen (NBP3-17254PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GPAA1 Recombinant Protein Antigen (NBP3-17254PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GPAA1 Products

Blogs on GPAA1

There are no specific blogs for GPAA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GPAA1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GPAA1