GPAA1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

GPAA1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPAA1
  
  

  Source: E. coli

  Amino Acid Sequence: MQSSPLQGRAGAIQAAVALELSSDVVTSLDVAVEGLNGQLPNLDLLNLFQTFCQKGGLLCTLQGKLQPEDWTSLDGPL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: GPAA1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17254.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GPAA1 Recombinant Protein Antigen

• anchor attachment protein 1 (Gaa1p, yeast) homolog
• GAA1 protein homolog
• GAA1glycophosphatidylinositol anchor attachment 1
• glycosylphosphatidylinositol anchor attachment protein 1 homolog (yeast)
• GPAA1P anchor attachment protein 1 homolog (yeast)
• GPAA1P anchor attachment protein 1 homolog
• GPI anchor attachment protein 1
• GPI transamidase subunit
• hGAA1glycosylphosphatidylinositol anchor attachment 1 protein

Background

The GPAA1 gene codes for a post-translational glycosylphosphatidylinositol (GPI) anchor attachment 1 protein at the GPI transfer step but is not essential for GPI synthesis. This protein functions as a general mechanism to link proteins to the cell surface membrane and is coded before/during the formation of the carbonyl intermediate. Isoform 1 is 621 amino acids in length at 67 kDA while isoform 2 exists at 561 amino acids long at 61 kDA. GPAA1 participates in various metabolic pathways as well as post-translational protein modification through interactions with genes PRR13, ALPP, PIN1, EIF3E, and GRIK5. GPAA1 has been investigated regarding various diseases such as ataxia, hepatocellular carcinoma, and breast cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: GPAA1