![Western Blot: GNRPX Antibody [H00055111-B01P] - Analysis of PLEKHJ1 expression in transfected 293T cell line by PLEKHJ1 polyclonal antibody. Lane 1: PLEKHJ1 transfected lysate(16.39 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/GNRPX-Antibody-Western-Blot-H00055111-B01P-img0004.jpg "Western Blot: GNRPX Antibody [H00055111-B01P] - Analysis of PLEKHJ1 expression in transfected 293T cell line by PLEKHJ1 polyclonal antibody. Lane 1: PLEKHJ1 transfected lysate(16.39 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse GNRPX Antibody - Azide and BSA Free (H00055111-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | PLEKHJ1 (NP_060519.1, 1 a.a. - 149 a.a.) full-length human protein. MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEPVGALLLERCRVVREEPGTFSISFIEDPERKYHFECSSEEQCQEWMEALRRASYEFMRRSLIFYRNEIRKVTGKDPLEQFGISEEARFQLSGLQA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | PLEKHJ1 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is useful for Western Blot, Functional, Immunofluorescence |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PLEKHJ1 |
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: GNRPX Antibody [H00055111-B01P] - Analysis of purified antibody to PLEKHJ1 on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/GNRPX-Antibody-Immunocytochemistry-Immunofluorescence-H00055111-B01P-img0003.jpg "Immunocytochemistry/Immunofluorescence: GNRPX Antibody [H00055111-B01P] - Analysis of purified antibody to PLEKHJ1 on HeLa cell. (antibody concentration 10 ug/ml)")
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")