GM632 Antibody

Images

 
Western Blot: GM632 Antibody [NBP2-84990] - WB Suggested Anti-ZNF512B Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human Placenta

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GM632 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GM632. Peptide sequence: ALKCQHCRKQFKSKAGLNYHTMAEHSAKPSDAEASEGGEQEERERLRKVL The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (92%), Rat (92%), Canine (100%), Equine (92%), Rabbit (92%), Guinea Pig (92%), Bovine (92%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF512B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GM632 Antibody

  • GM632
  • KIAA1196
  • MGC149845
  • MGC149846
  • zinc finger protein 512B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89766
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1436
Species: Mu
Applications: WB
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB600-302
Species: Hu, Mu, Bv, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Flow-IC
NBP1-03349
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-67899
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for GM632 Antibody (NBP2-84990) (0)

There are no publications for GM632 Antibody (NBP2-84990).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GM632 Antibody (NBP2-84990) (0)

There are no reviews for GM632 Antibody (NBP2-84990). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GM632 Antibody (NBP2-84990) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GM632 Products

Bioinformatics Tool for GM632 Antibody (NBP2-84990)

Discover related pathways, diseases and genes to GM632 Antibody (NBP2-84990). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GM632 Antibody (NBP2-84990)

Discover more about diseases related to GM632 Antibody (NBP2-84990).
 

Pathways for GM632 Antibody (NBP2-84990)

View related products by pathway.

Blogs on GM632

There are no specific blogs for GM632, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GM632 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF512B