We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Gamma Adaptin Recombinant Protein Antigen

Images

 
There are currently no images for Gamma Adaptin Recombinant Protein Antigen (NBP3-24861PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Gamma Adaptin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Gamma Adaptin

Source: E.coli

Amino Acid Sequence: VPELMEMFLPATKNLLNEKNHGVLHTSVVLLTEMCERSPDMLAHFRKNEKLVPQLVRILKNLIMSGYSPEHDVSGI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
AP1G1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24861It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Gamma Adaptin Recombinant Protein Antigen

  • Adapter-related protein complex 1 subunit gamma-1
  • Adaptor protein complex AP-1 subunit gamma-1
  • adaptor-related protein complex 1, gamma 1 subunit
  • ADTGclathrin assembly protein complex 1 gamma large chain
  • AP-1 complex subunit gamma-1
  • CLAPG1clathrin-associated/assembly/adaptor protein, large, gamma 1
  • Clathrin assembly protein complex 1 gamma-1 large chain
  • gamma adaptin
  • gamma1-adaptin
  • golgi adaptor HA1/AP1 adaptin gamma subunit
  • Golgi adaptor HA1/AP1 adaptin subunit gamma-1
  • MGC18255

Background

Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is composed of four classes of molecules named alpha, beta, beta prime and gamma adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. The protein encoded by this gene is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NB100-56530
Species: Hu
Applications: WB
NBP3-16602
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-89544
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP1-81857
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-49402
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-46862
Species: Hu
Applications: ICC/IF, WB
H00026088-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
NBP1-31329
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-82590
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-90879
Species: Hu
Applications: IHC,  IHC-P, WB
H00084333-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP3-25690
Species: Fe, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF2255
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
NBP3-46237
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB

Publications for Gamma Adaptin Recombinant Protein Antigen (NBP3-24861PEP) (0)

There are no publications for Gamma Adaptin Recombinant Protein Antigen (NBP3-24861PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gamma Adaptin Recombinant Protein Antigen (NBP3-24861PEP) (0)

There are no reviews for Gamma Adaptin Recombinant Protein Antigen (NBP3-24861PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Gamma Adaptin Recombinant Protein Antigen (NBP3-24861PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Gamma Adaptin Products

Research Areas for Gamma Adaptin Recombinant Protein Antigen (NBP3-24861PEP)

Find related products by research area.

Blogs on Gamma Adaptin

There are no specific blogs for Gamma Adaptin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Gamma Adaptin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AP1G1