Gamma Adaptin Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Gamma Adaptin Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Gamma Adaptin
  
  

  Source: E.coli

  Amino Acid Sequence: VPELMEMFLPATKNLLNEKNHGVLHTSVVLLTEMCERSPDMLAHFRKNEKLVPQLVRILKNLIMSGYSPEHDVSGI

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: AP1G1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24861It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Gamma Adaptin Recombinant Protein Antigen

• Adapter-related protein complex 1 subunit gamma-1
• Adaptor protein complex AP-1 subunit gamma-1
• adaptor-related protein complex 1, gamma 1 subunit
• ADTGclathrin assembly protein complex 1 gamma large chain
• AP-1 complex subunit gamma-1
• CLAPG1clathrin-associated/assembly/adaptor protein, large, gamma 1
• Clathrin assembly protein complex 1 gamma-1 large chain
• gamma adaptin
• gamma1-adaptin
• golgi adaptor HA1/AP1 adaptin gamma subunit
• Golgi adaptor HA1/AP1 adaptin subunit gamma-1
• MGC18255

Background

Adaptins are important components of clathrin-coated vesicles transporting ligand-receptor complexes from the plasma membrane or from the trans-Golgi network to lysosomes. The adaptin family of proteins is composed of four classes of molecules named alpha, beta, beta prime and gamma adaptins. Adaptins, together with medium and small subunits, form a heterotetrameric complex called an adaptor, whose role is to promote the formation of clathrin-coated pits and vesicles. The protein encoded by this gene is a gamma-adaptin protein and it belongs to the adaptor complexes large subunits family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AP1G1