GALNT12 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit GALNT12 Antibody - BSA Free (NBP2-14035) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: PEGCIAVEAGMDTLIMHLCEETAPENQKFILQEDGSLFHEQSKKCVQAARKESSDSFVPLLRDCTNSDHQK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GALNT12 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for GALNT12 Antibody - BSA Free
Background
GALNT12, also known as Polypeptide N-acetylgalactosaminyltransferase 12, has a 581 amino acid long isoform that is 67 kDa and a short 272 amino acid isoform that is 32 kDa, plays role in catalyzing the initial reaction in O-linked oligosaccharide biosynthesis, and the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor; displays activity toward non-glycosylated peptides such as Muc5AC, Muc1a and EA2, Gal-NAc-Muc5AC glycopeptide; and initializes mucin-type oligosaccharide biosynthesis in digestive organs. Studies on this protein have shown a relationship with the following disorders and diseases: colorectal cancer, colon cancer, cerebritis, thyroiditis, and prostatitis. This protein has also been shown to have interactions with MUC7, MUC1, MUC2, MUC5AC, and C1GALT1 in the pathways such as the O-linked glycosylation of mucins, metabolism of proteins, post-translational protein modification, and mucin type O-Glycan biosynthesis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Pm, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Hu
Applications: EnzAct
Species: Hu, Rt
Applications: IHC, WB
Species: Bv(-), Ch, Fe, Hu, Ma, Pm, Mu, Po, Rb, Rt
Applications: DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC
Publications for GALNT12 Antibody (NBP2-14035) (0)
There are no publications for GALNT12 Antibody (NBP2-14035).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GALNT12 Antibody (NBP2-14035) (0)
There are no reviews for GALNT12 Antibody (NBP2-14035).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for GALNT12 Antibody (NBP2-14035) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GALNT12 Products
Research Areas for GALNT12 Antibody (NBP2-14035)
Find related products by research area.
|
Blogs on GALNT12