GALNT12 Antibody


Immunohistochemistry-Paraffin: GALNT12 Antibody [NBP2-14035] - Staining of human fallopian tube shows low expression as expected.
Immunohistochemistry-Paraffin: GALNT12 Antibody [NBP2-14035] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: GALNT12 Antibody [NBP2-14035] - Staining in human epididymis and fallopian tube tissues using anti-GALNT12 antibody. Corresponding GALNT12 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

GALNT12 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PEGCIAVEAGMDTLIMHLCEETAPENQKFILQEDGSLFHEQSKKCVQAAR KESSDSFVPLLRDCTNSDHQK
Specificity of human GALNT12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GALNT12 Protein (NBP2-14035PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GALNT12 Antibody

  • colorectal cancer, susceptibility to 1
  • CRCS1
  • EC
  • FLJ21212
  • GalNAc-T12
  • GALNT12
  • Polypeptide GalNAc transferase 12
  • polypeptide N-acetylgalactosaminyltransferase 12
  • Pp-GaNTase 12
  • Protein-UDP acetylgalactosaminyltransferase 12
  • UDP-GalNAc: polypeptide N-acetylgalactosaminyltransferase
  • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 12
  • UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 12 (GalNAc-T12)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
Species: Hu
Applications: IHC, IHC-P

Publications for GALNT12 Antibody (NBP2-14035) (0)

There are no publications for GALNT12 Antibody (NBP2-14035).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GALNT12 Antibody (NBP2-14035) (0)

There are no reviews for GALNT12 Antibody (NBP2-14035). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GALNT12 Antibody (NBP2-14035) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GALNT12 Products

Bioinformatics Tool for GALNT12 Antibody (NBP2-14035)

Discover related pathways, diseases and genes to GALNT12 Antibody (NBP2-14035). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GALNT12 Antibody (NBP2-14035)

Discover more about diseases related to GALNT12 Antibody (NBP2-14035).

Pathways for GALNT12 Antibody (NBP2-14035)

View related products by pathway.

PTMs for GALNT12 Antibody (NBP2-14035)

Learn more about PTMs related to GALNT12 Antibody (NBP2-14035).

Research Areas for GALNT12 Antibody (NBP2-14035)

Find related products by research area.

Blogs on GALNT12

There are no specific blogs for GALNT12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GALNT12 Antibody and receive a gift card or discount.


Gene Symbol GALNT12