We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

GALNT11 Recombinant Protein Antigen

Images

 
There are currently no images for GALNT11 Protein (NBP1-82140PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GALNT11 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GALNT11.

Source: E. coli

Amino Acid Sequence: LKTKSYGNISERVELRKKLGCKSFKWYLDNVYPEMQISGSHAKPQQPIFVNRGPKRPKVLQRGRLYHLQTNKCLVAQGRPSQKGGLVVLKACDYSDPNQIWIYNEEHELVLNSLLCLDMSETRSSDPPRLMKCHGSG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GALNT11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82140.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GALNT11 Recombinant Protein Antigen

  • EC 2.4.1.41
  • FLJ21634
  • GalNAc-T11
  • GALNT11
  • MGC71630
  • Polypeptide GalNAc transferase 11
  • polypeptide N-acetylgalactosaminyltransferase 11
  • Pp-GaNTase 11
  • Protein-UDP acetylgalactosaminyltransferase 11
  • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 11
  • UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 11 (GalNAc-T11)

Background

The enzyme coded for by the GALNT11 gene catalyzes the initial reaction in O-linked (mucin-type) oligosaccharide biosynthesis by transfering an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. One isoform exists at 608 amino acids long with a mass of nearly 69 kDA while the other is only 202 amino acids in length and is approximately 23 kDA. The GALNT11 gene interacts with MUC4, GALNT1, GALNT3, GALNT5, and GALNT12 in the metabolism of proteins and post-translational protein modification.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004751-M11
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP3-35691
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-1471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, PEP-ELISA, WB
AF-241-NA
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut, WB
NBP1-82953
Species: Hu
Applications: ICC/IF
9077-GT
Species: Hu
Applications: EnzAct
NBP1-81848
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38936
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00009475-M02
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
AF7388
Species: Hu
Applications: IHC
NBP2-39021
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-05793
Species: Hu
Applications: IHC,  IHC-P
NBP1-81845
Species: Hu
Applications: IHC,  IHC-P, WB
8906-GT
Species: Hu
Applications: EnzAct

Publications for GALNT11 Protein (NBP1-82140PEP) (0)

There are no publications for GALNT11 Protein (NBP1-82140PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GALNT11 Protein (NBP1-82140PEP) (0)

There are no reviews for GALNT11 Protein (NBP1-82140PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GALNT11 Protein (NBP1-82140PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GALNT11 Products

Blogs on GALNT11

There are no specific blogs for GALNT11, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GALNT11 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GALNT11