Recombinant Human GAGE5 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human GAGE5 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 28-117 of Human GAGE5

Source: Wheat Germ (in vitro)

Amino Acid Sequence: RPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
GAGE5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
35.64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GAGE5 GST (N-Term) Protein

  • cancer/testis antigen family 4, member 5
  • CT4.5Cancer/testis antigen 4.5
  • G antigen 5
  • GAGE-5

Background

This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The antigenic peptide YYWPRPRRY, which is also encoded by several other family members, is recognized by autologous cytolytic T lymphocytes. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004102-M01
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB
NBP2-54704
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-09603
Species: Hu
Applications: WB
NBP3-05152
Species: Hu, Mu
Applications: ICC/IF, WB
H00266740-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-01863
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-76932
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBL1-10940
Species: Hu
Applications: WB
NBP2-94256
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
H00004101-M01
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP2-34754
Species: Ca, Hu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P
NBP2-41318
Species: Hu, Mu, Rt
Applications: ELISA, ICC, IF, IHC, IHC-P, WB
NBP2-92653
Species: Hu, Mu, Rt
Applications: ICC/IF, KO, WB

Publications for GAGE5 Partial Recombinant Protein (H00002577-Q01) (0)

There are no publications for GAGE5 Partial Recombinant Protein (H00002577-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAGE5 Partial Recombinant Protein (H00002577-Q01) (0)

There are no reviews for GAGE5 Partial Recombinant Protein (H00002577-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GAGE5 Partial Recombinant Protein (H00002577-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GAGE5 Products

Array H00002577-Q01

Bioinformatics Tool for GAGE5 Partial Recombinant Protein (H00002577-Q01)

Discover related pathways, diseases and genes to GAGE5 Partial Recombinant Protein (H00002577-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on GAGE5

There are no specific blogs for GAGE5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GAGE5 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GAGE5