FRAS1 Related Extracellular Matrix 3 Antibody

Images

 
Immunohistochemistry: FRAS1 Related Extracellular Matrix 3 Antibody [NBP2-30847] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FRAS1 Related Extracellular Matrix 3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QHDAFSLILSKDSYQWVVGNSIIEKVQVQVTVLPVDNVGPKVLVGESFIVYEGEKNSLTLQHLHVEDVDTHQDELLCTVTSQPA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FRAS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FRAS1 Related Extracellular Matrix 3 Protein (NBP2-30847PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FRAS1 Related Extracellular Matrix 3 Antibody

  • FRAS1-Related Extracellular Matrix Protein 3
  • FREM3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77181
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IF
NBP1-85049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77180
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IF
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
BC110-60480
Species: Hu, Mu
Applications: ICC/IF, PEP-ELISA
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
H00085329-T01
Species: Hu
H00030845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for FRAS1 Related Extracellular Matrix 3 Antibody (NBP2-30847) (0)

There are no publications for FRAS1 Related Extracellular Matrix 3 Antibody (NBP2-30847).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FRAS1 Related Extracellular Matrix 3 Antibody (NBP2-30847) (0)

There are no reviews for FRAS1 Related Extracellular Matrix 3 Antibody (NBP2-30847). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FRAS1 Related Extracellular Matrix 3 Antibody (NBP2-30847) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FRAS1 Related Extracellular Matrix 3 Products

Bioinformatics Tool for FRAS1 Related Extracellular Matrix 3 Antibody (NBP2-30847)

Discover related pathways, diseases and genes to FRAS1 Related Extracellular Matrix 3 Antibody (NBP2-30847). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FRAS1 Related Extracellular Matrix 3 Antibody (NBP2-30847)

Discover more about diseases related to FRAS1 Related Extracellular Matrix 3 Antibody (NBP2-30847).
 

Pathways for FRAS1 Related Extracellular Matrix 3 Antibody (NBP2-30847)

View related products by pathway.

Blogs on FRAS1 Related Extracellular Matrix 3

There are no specific blogs for FRAS1 Related Extracellular Matrix 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FRAS1 Related Extracellular Matrix 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FRAS1
Uniprot