We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

FGGY carbohydrate kinase domain containing Recombinant Protein Antigen

Images

 
There are currently no images for FGGY carbohydrate kinase domain containing Recombinant Protein Antigen (NBP3-24712PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FGGY carbohydrate kinase domain containing Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FGGY carbohydrate kinase domain containing

Source: E.coli

Amino Acid Sequence: TGLKLSQDLDDLAILYLATVQAIALGTRFIIEAMEAAGHSISTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
FGGY
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24712It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FGGY carbohydrate kinase domain containing Recombinant Protein Antigen

  • EC 2.7.1
  • EC 2.7.1.-
  • FGGY carbohydrate kinase domain containing
  • FGGY carbohydrate kinase domain-containing protein
  • FLJ10986

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2360
Species: Hu
Applications: CyTOF-ready, Flow, IP
AF1436
Species: Mu
Applications: WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-91074
Species: Hu
Applications: IHC,  IHC-P
NBP1-86623
Species: Hu
Applications: ICC/IF,  IHC-P, WB
NBP1-89567
Species: Hu
Applications: ICC/IF, WB
NB100-2466
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP1-89445
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for FGGY carbohydrate kinase domain containing Recombinant Protein Antigen (NBP3-24712PEP) (0)

There are no publications for FGGY carbohydrate kinase domain containing Recombinant Protein Antigen (NBP3-24712PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGGY carbohydrate kinase domain containing Recombinant Protein Antigen (NBP3-24712PEP) (0)

There are no reviews for FGGY carbohydrate kinase domain containing Recombinant Protein Antigen (NBP3-24712PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FGGY carbohydrate kinase domain containing Recombinant Protein Antigen (NBP3-24712PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FGGY carbohydrate kinase domain containing Products

Research Areas for FGGY carbohydrate kinase domain containing Recombinant Protein Antigen (NBP3-24712PEP)

Find related products by research area.

Blogs on FGGY carbohydrate kinase domain containing

There are no specific blogs for FGGY carbohydrate kinase domain containing, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ITPR2 Antibody
NB100-2466

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FGGY carbohydrate kinase domain containing Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FGGY