FBXO47 Antibody

Images

 
Immunohistochemistry: FBXO47 Antibody [NBP2-31679] - Staining of small intestine.
Immunohistochemistry: FBXO47 Antibody [NBP2-31679] - Staining of human small intestine shows strong positivity in paneth cells.
Immunohistochemistry: FBXO47 Antibody [NBP2-31679] - Staining of small intestine.
Immunohistochemistry: FBXO47 Antibody [NBP2-31679] - Staining of liver cancer.
Immunohistochemistry: FBXO47 Antibody [NBP2-31679] - Staining of human small intestine shows strong positivity in paneth cells.
Immunohistochemistry: FBXO47 Antibody [NBP2-31679] - Staining of liver cancer.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FBXO47 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: WLTRILKPWPMVNQARLLYIIFGPISPQDGQVVWQEMIEEPTDEFSLKGLADAIKLLYDASTKEWTADDVISLVDELSVVPREWLLENNARLLMLSGNNICFSFMASK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBXO47
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FBXO47 Protein (NBP2-31679PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FBXO47 Antibody

  • F-box only protein 47
  • F-box protein 47

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91611
Species: Mu
Applications: WB
AF6817
Species: Hu
Applications: WB
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-84045
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FBXO47 Antibody (NBP2-31679) (0)

There are no publications for FBXO47 Antibody (NBP2-31679).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXO47 Antibody (NBP2-31679) (0)

There are no reviews for FBXO47 Antibody (NBP2-31679). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FBXO47 Antibody (NBP2-31679) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FBXO47 Products

FBXO47 NBP2-31679

Bioinformatics Tool for FBXO47 Antibody (NBP2-31679)

Discover related pathways, diseases and genes to FBXO47 Antibody (NBP2-31679). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXO47 Antibody (NBP2-31679)

Discover more about diseases related to FBXO47 Antibody (NBP2-31679).
 

Pathways for FBXO47 Antibody (NBP2-31679)

View related products by pathway.

Blogs on FBXO47

There are no specific blogs for FBXO47, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBXO47 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXO47
Uniprot