FAM55B Antibody


Immunohistochemistry-Paraffin: FAM55B Antibody [NBP2-30771] - Staining of human epididymis shows high expression.
Immunohistochemistry: FAM55B Antibody [NBP2-30771] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in renal tubules.
Immunohistochemistry-Paraffin: FAM55B Antibody [NBP2-30771] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: FAM55B Antibody [NBP2-30771] - Staining in human epididymis and endometrium tissues using anti-NXPE2 antibody. Corresponding NXPE2 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

FAM55B Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: KDHTKFSFNLENHIILNQGNIFKKYSHSETPLCPAVSPKETELRIKDIMEKLDQQ
Specificity of human FAM55B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FAM55B Protein (NBP2-30771PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FAM55B Antibody

  • Family With Sequence Similarity 55, Member B
  • FLJ25224
  • Neurexophilin And PC-Esterase Domain Family, Member 2
  • NXPE Family Member 2
  • NXPE2
  • Protein FAM55B


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Flow, IHC-P, IF
Species: Hu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, MiAr
Species: Hu
Applications: IHC, IHC-P

Publications for FAM55B Antibody (NBP2-30771) (0)

There are no publications for FAM55B Antibody (NBP2-30771).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM55B Antibody (NBP2-30771) (0)

There are no reviews for FAM55B Antibody (NBP2-30771). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FAM55B Antibody (NBP2-30771) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FAM55B Products

Bioinformatics Tool for FAM55B Antibody (NBP2-30771)

Discover related pathways, diseases and genes to FAM55B Antibody (NBP2-30771). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM55B

There are no specific blogs for FAM55B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FAM55B Antibody and receive a gift card or discount.


Gene Symbol NXPE2