FAM173B Antibody

Images

 
Western Blot: FAM173B Antibody [NBP1-60086] - Human Lung lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM173B Antibody Summary

Immunogen
Synthetic peptides corresponding to LOC134145 The peptide sequence was selected from the N terminal of LOC134145. Peptide sequence EGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNWGFLLTGLVGGTLVAV.
Predicted Species
Human (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM173B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LOC134145 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FAM173B Antibody

  • family with sequence similarity 173, member B
  • FLJ20667
  • hypothetical protein LOC134145

Background

The exact function of LOC134145 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82069
Species: Hu
Applications: WB, IHC, IHC-P
H00001406-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF, S-ELISA
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
AF1056
Species: Rt
Applications: WB, IHC
NBP1-31317
Species: Hu, Rt
Applications: WB, ICC/IF
AF1916
Species: Hu
Applications: WB, IHC, ICC
NB110-2546
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Fi, Gt, Rb
Applications: WB, ChIP, Flow, IA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP1-97493
Species: Hu, Mu, Rt, Eq, Fi, Rb
Applications: WB, EIA, IHC, IHC-P

Publications for FAM173B Antibody (NBP1-60086) (0)

There are no publications for FAM173B Antibody (NBP1-60086).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM173B Antibody (NBP1-60086) (0)

There are no reviews for FAM173B Antibody (NBP1-60086). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM173B Antibody (NBP1-60086) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAM173B Products

Bioinformatics Tool for FAM173B Antibody (NBP1-60086)

Discover related pathways, diseases and genes to FAM173B Antibody (NBP1-60086). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM173B

There are no specific blogs for FAM173B, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM173B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM173B
Uniprot