FAM154A Antibody Summary
Immunogen |
Synthetic peptides corresponding to C9ORF138 The peptide sequence was selected from the N terminal of C9ORF138.
Peptide sequence SEYTENYPFYHSYLPRESFKPRREYQKGSIPMEGLTTSRRDFGPHKVAPV. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
FAM154A |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:100-1:2000
|
Application Notes |
This is a rabbit polyclonal antibody against C9orf138 and was validated on Western blot. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Purity |
Immunogen affinity purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for FAM154A Antibody
Background
The specific function of the protein remains unknown.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Publications for FAM154A Antibody (NBP1-56586) (0)
There are no publications for FAM154A Antibody (NBP1-56586).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FAM154A Antibody (NBP1-56586) (0)
There are no reviews for FAM154A Antibody (NBP1-56586).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
- 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FAM154A Antibody (NBP1-56586) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FAM154A Products
Bioinformatics Tool for FAM154A Antibody (NBP1-56586)
Discover related pathways, diseases and genes to FAM154A Antibody (NBP1-56586). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for FAM154A Antibody (NBP1-56586)
Discover more about diseases related to FAM154A Antibody (NBP1-56586).
|
Blogs on FAM154A