![Western Blot: FAM154A Antibody [NBP1-56586] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize2/FAM154A Antibody-Western Blot-NBP1-56586-img0002.jpg "Western Blot: FAM154A Antibody [NBP1-56586] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Synthetic peptides corresponding to C9ORF138 The peptide sequence was selected from the N terminal of C9ORF138.
Peptide sequence SEYTENYPFYHSYLPRESFKPRREYQKGSIPMEGLTTSRRDFGPHKVAPV. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FAM154A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This is a rabbit polyclonal antibody against C9orf138 and was validated on Western blot. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for FAM154A Antibody (NBP1-56586)Discover more about diseases related to FAM154A Antibody (NBP1-56586).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: DIS3L2 Antibody [NBP1-84740] - Staining of human fallopian tube shows cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/DIS3L2-Antibody-Immunohistochemistry-Paraffin-NBP1-84740-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: TSSC4 Antibody [NBP1-85838] - Staining of human cell line U-2 OS shows positivity in plasma membrane and cytoplasm.](http://images.novusbio.com/fullsize2/TSSC4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85838-img0005.jpg)
![Immunohistochemistry-Paraffin: TSSC4 Antibody [NBP1-85838] - Staining of human kidney shows strong cytoplasmic and moderate nuclear positivity in subsets of tubules.](http://images.novusbio.com/fullsize2/TSSC4-Antibody-Immunohistochemistry-Paraffin-NBP1-85838-img0006.jpg)
![Western Blot: Patched 1 Antibody [NB200-118]-Analysis of Human PTCH1 in Fetal brain Lysate with anti huPTCH1 at a 1:500 dilution.](http://images.novusbio.com/fullsize/Patched 1 Antibody-Western Blot-NB200-118-img0001.jpg)
![Western Blot: Aggrecan Neoepitope Antibody [NB100-74350] - Analysis of ACAN in L929 whole cell extract using NB100-74350.](http://images.novusbio.com/fullsize2/Aggrecan Neoepitope Antibody-Western Blot-NB100-74350-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: Aggrecan Neoepitope Antibody [NB100-74350] - Detection of ACAN in OA cartilage using NB100-74350.](http://images.novusbio.com/fullsize2/Aggrecan Neoepitope Antibody-Immunocytochemistry-Immunofluorescence-NB100-74350-img0007.jpg)
![Immunohistochemistry: Aggrecan Neoepitope Antibody [NB100-74350] - Analysis of ACAN in mouse cartilage with hematoxylin counterstain.](http://images.novusbio.com/fullsize2/Aggrecan-Neoepitope-Antibody-Immunohistochemistry-NB100-74350-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: FAM59A Antibody [NBP2-47460] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.](http://images.novusbio.com/fullsize2/FAM59A Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47460-img0003.jpg)
![Immunohistochemistry: FAM59A Antibody [NBP2-47460] - Staining of human cerebral cortex shows moderate nuclear staining in neuronal cells](http://images.novusbio.com/fullsize2/FAM59A-Antibody-Immunohistochemistry-NBP2-47460-img0002.jpg)
![Immunohistochemistry-Paraffin: GPR133 Antibody [NBP1-85142] - Staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells with distinct extracellular material.](http://images.novusbio.com/fullsize2/GPR133-Antibody-Immunohistochemistry-Paraffin-NBP1-85142-img0004.jpg)
![Western Blot: KIF18A Antibody [NBP1-85126] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize2/KIF18A-Antibody-Western-Blot-NBP1-85126-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: KIF18A Antibody [NBP1-85126] - Staining of human cell line U-2 OS shows localization to cytosol, microtubules & cytokinetic bridge.](http://images.novusbio.com/fullsize2/KIF18A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85126-img0006.jpg)
![Immunohistochemistry-Paraffin: KIF18A Antibody [NBP1-85126] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/KIF18A-Antibody-Immunohistochemistry-Paraffin-NBP1-85126-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: NINL Antibody [NBP1-81451] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & cytokinetic bridge.](http://images.novusbio.com/fullsize2/NINL-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81451-img0005.jpg)
![Immunohistochemistry-Paraffin: NINL Antibody [NBP1-81451] - Staining of human cerebellum shows moderate cytoplasmic positivity in purkinje cells.](http://images.novusbio.com/fullsize2/NINL-Antibody-Immunohistochemistry-Paraffin-NBP1-81451-img0003.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0005.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.")