FAM132B Antibody

Immunocytochemistry/Immunofluorescence: FAM132B Antibody [NBP2-57732] - Staining of human cell line RH-30 shows localization to endoplasmic reticulum & microtubule organizing center.

Product Discontinued

FAM132B Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EPTAERAHSVDPRDAWMLFVRQSDKGVNGKKRSRGKAKKLKFGLPGP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FAM132B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunoprecipitation Reported in scientific literature (PMID:31400017)
  • Western Blot Reported in scientific literature (PMID:31400017)
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for FAM132B Antibody

• C1qTNF15
• Complement C1q Tumor Necrosis Factor-Related Protein 15
• CTRP15
• ERFE
• Erythroferrone
• FAM132B
• Family With Sequence Similarity 132, Member B
• Myonectin
• Protein FAM132B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM132B Antibody (NBP2-57732)(2)

Publications using NBP2-57732

• De Rosa G, Andolfo I, Marra R et al. RAP-011 Rescues the Disease Phenotype in a Cellular Model of Congenital Dyserythropoietic Anemia Type II by Inhibiting the SMAD2-3 Pathway Int J Mol Sci 2020-08-04 [PMID: 32759740] (WB, Human)
• Andolfo I, Rosato BE, Marra R et al. The BMP-SMAD pathway mediates the impaired hepatic iron metabolism associated with the ERFE-A260S variant Am. J. Hematol. 2019-08-10 [PMID: 31400017] (IP, WB, Human)

Bioinformatics

• Gene Symbol: FAM132B