FAM125B Antibody

Images

 
Western Blot: FAM125B Antibody [NBP2-13979] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: FAM125B Antibody [NBP2-13979] - Staining of human cell line Hep G2 shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FAM125B Antibody [NBP2-13979] - Staining of human placenta shows cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM125B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QSTMPEVKDLSEALPETSMDPITGVGVVASRNRAPTGYDVVAQTADGVDA DLWKDGLFKSKVTRYLCFTRSFSKENSHLGNVL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MVB12B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM125B Protein (NBP2-13979PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM125B Antibody

  • C9orf28
  • chromosome 9 open reading frame 28
  • ESCRT-I complex subunit MVB12B
  • family with sequence similarity 125, member B
  • FLJ00001
  • multivesicular body subunit 12B
  • Protein FAM125B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91882
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-112
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP1-85976
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-90626
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13979
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FAM125B Antibody (NBP2-13979) (0)

There are no publications for FAM125B Antibody (NBP2-13979).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM125B Antibody (NBP2-13979) (0)

There are no reviews for FAM125B Antibody (NBP2-13979). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAM125B Antibody (NBP2-13979) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM125B Products

Bioinformatics Tool for FAM125B Antibody (NBP2-13979)

Discover related pathways, diseases and genes to FAM125B Antibody (NBP2-13979). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM125B Antibody (NBP2-13979)

Discover more about diseases related to FAM125B Antibody (NBP2-13979).
 

Pathways for FAM125B Antibody (NBP2-13979)

View related products by pathway.

PTMs for FAM125B Antibody (NBP2-13979)

Learn more about PTMs related to FAM125B Antibody (NBP2-13979).

Blogs on FAM125B

There are no specific blogs for FAM125B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM125B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MVB12B