FAHD2A Antibody - BSA Free

Western Blot: FAHD2A Antibody [NBP2-54717] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane 6: Human Tonsil tissue

Immunohistochemistry-Paraffin: FAHD2A Antibody [NBP2-54717] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FAHD2A Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids: KWPFQPSRDMRLVQFRAPHLVGPHLGLETGNGGGVINLNAFDPTLPKTMTQFLEQGEATLSVARRALAAQLPVLP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FAHD2A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FAHD2A Recombinant Protein Antigen (NBP2-54717PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FAHD2A Antibody - BSA Free

• CGI-105
• EC 3.-
• fumarylacetoacetate hydrolase domain containing 1
• fumarylacetoacetate hydrolase domain containing 2A
• fumarylacetoacetate hydrolase domain-containing protein 2A
• MGC131995

Background

FAHD2A may have hydrolase activity

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FAHD2A