ERP27 Antibody


Western Blot: ERP27 Antibody [NBP1-88393] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with more
Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393] - Staining in human pancreas and colon tissues using anti-ERP27 antibody. Corresponding ERP27 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393] - Staining of human pancreas shows high expression.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ERP27 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ILVDSGMKENGKVISFFKLKESQLPALAIYQTLDDEWDTLPTAEVSVEHVQNFCDGFLSGKLLKENRESEGKTPKV
Specificity of human ERP27 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ERP27 Protein (NBP1-88393PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ERP27 Antibody

  • C12orf46
  • chromosome 12 open reading frame 46
  • endoplasmic reticulum protein 27 kDa
  • endoplasmic reticulum protein 27
  • endoplasmic reticulum resident protein 27
  • ER protein 27
  • ERp27
  • FLJ32115
  • PDIA8
  • protein disulfide isomerase family A, member 8


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA

Publications for ERP27 Antibody (NBP1-88393) (0)

There are no publications for ERP27 Antibody (NBP1-88393).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERP27 Antibody (NBP1-88393) (0)

There are no reviews for ERP27 Antibody (NBP1-88393). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ERP27 Antibody (NBP1-88393) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ERP27 Products

Bioinformatics Tool for ERP27 Antibody (NBP1-88393)

Discover related pathways, diseases and genes to ERP27 Antibody (NBP1-88393). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERP27 Antibody (NBP1-88393)

Discover more about diseases related to ERP27 Antibody (NBP1-88393).

Pathways for ERP27 Antibody (NBP1-88393)

View related products by pathway.

Blogs on ERP27

There are no specific blogs for ERP27, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ERP27 Antibody and receive a gift card or discount.


Gene Symbol ERP27