ERP27 Antibody - BSA Free

Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393] - Staining in human pancreas and colon tissues using anti-ERP27 antibody. Corresponding ERP27 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393] - Staining of human pancreas shows high expression.

Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393] - Staining of human colon shows low expression as expected.

Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393] - Staining of human testis.

Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393] - Staining of human colon, liver, pancreas and testis using Anti-ERP27 antibody NBP1-88393 (A) shows similar protein distribution across tissues to independent antibody NBP2-38679 (B).

Immunohistochemistry-Paraffin: ERP27 Antibody [NBP1-88393] - Staining of human liver.

Analysis in control (vector only transfected HEK293T lysate) and ERP27 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ERP27 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ERP27 Antibody - BSA Free (NBP1-88393) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ILVDSGMKENGKVISFFKLKESQLPALAIYQTLDDEWDTLPTAEVSVEHVQNFCDGFLSGKLLKENRESEGKTPKV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ERP27
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ERP27 Protein (NBP1-88393PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ERP27 Antibody - BSA Free

• C12orf46
• chromosome 12 open reading frame 46
• endoplasmic reticulum protein 27 kDa
• endoplasmic reticulum protein 27
• endoplasmic reticulum resident protein 27
• ER protein 27
• ERp27
• FLJ32115
• PDIA8
• protein disulfide isomerase family A, member 8

Background

ERP27 is a noncatalytic member of the protein disulfide isomerase (PDI; see MIM 608012) family of endoplasmic reticulum (ER) proteins (Alanen et al., 2006 [PubMed 16940051]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ERP27