ERMP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ERMP1 Antibody [NBP2-13970] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & nucleoli.
Immunohistochemistry: ERMP1 Antibody [NBP2-13970] - Staining of human appendix shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ERMP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SSNPANPKPKRVFLQHMTRTFHDLEGNAVKRDSGIWINGFDYTGISHITP HIPEINDSIRAHCEENAPLCGFPWYLPVHFLIRKNWYLPAPEVSPRNPPH FRLISKEQTPWDSIKLTFEATGPSHMSFYVRAHKGSTLSQWSLGNGTPV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ERMP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
Appendix Lysate (NB820-59343)
Control Peptide
ERMP1 Protein (NBP2-13970PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ERMP1 Antibody

  • endoplasmic reticulum metallopeptidase 1
  • plant and worm proteins)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-49600
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P
AF1555
Species: Hu
Applications: WB
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
AF3626
Species: Mu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-93465
Species: Hu
Applications: IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP2-49012
Species: Hu
Applications: IHC, IHC-P
H00115426-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB7557
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ERMP1 Antibody (NBP2-13970) (0)

There are no publications for ERMP1 Antibody (NBP2-13970).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERMP1 Antibody (NBP2-13970) (0)

There are no reviews for ERMP1 Antibody (NBP2-13970). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ERMP1 Antibody (NBP2-13970) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional ERMP1 Products

ERMP1 NBP2-13970

Bioinformatics Tool for ERMP1 Antibody (NBP2-13970)

Discover related pathways, diseases and genes to ERMP1 Antibody (NBP2-13970). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERMP1 Antibody (NBP2-13970)

Discover more about diseases related to ERMP1 Antibody (NBP2-13970).
 

Pathways for ERMP1 Antibody (NBP2-13970)

View related products by pathway.

PTMs for ERMP1 Antibody (NBP2-13970)

Learn more about PTMs related to ERMP1 Antibody (NBP2-13970).

Blogs on ERMP1

There are no specific blogs for ERMP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERMP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ERMP1