EIF4E2 Antibody (1A11)

Images

 
Western Blot: EIF4E2 Antibody (1A11) [H00009470-M02] - EIF4E2 monoclonal antibody (M02), clone 1A11 Analysis of EIF4E2 expression in MCF-7.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1A11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

EIF4E2 Antibody (1A11) Summary

Immunogen
EIF4E2 (NP_004837, 146 a.a. ~ 245 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP
Specificity
EIF4E2 - eukaryotic translation initiation factor 4E member 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EIF4E2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EIF4E2 Antibody (1A11)

  • 4EHP
  • 4E-LP
  • eIF4E type 2
  • eIF-4E type 2
  • EIF4EL3
  • eIF4E-like cap-binding protein
  • eIF4E-like protein 4E-LP
  • eukaryotic translation initiation factor 4E family member 2
  • Eukaryotic translation initiation factor 4E homologous protein
  • eukaryotic translation initiation factor 4E member 2
  • eukaryotic translation initiation factor 4E type 2
  • Eukaryotic translation initiation factor 4E-like 34E-LP
  • IF4e
  • mRNA cap-binding protein 4EHP
  • mRNA cap-binding protein type 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NB200-157
Species: Hu
Applications: IHC, IHC-P, KO, WB
NB100-1595
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NB100-268
Species: Hu, Po
Applications: IP, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-04416
Species: Mu, Rt
Applications: WB
UL-553
Species: Hu
Applications: EnzAct
NBP1-85702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84658
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92924
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
NBP2-75578
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-62664
Species: Hu
Applications: IHC, IHC-P
NBP2-50214
Species: Hu
Applications: ELISA, IHC, WB
AF6000
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NB100-1162
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-80423
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NB600-1049
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for EIF4E2 Antibody (H00009470-M02) (0)

There are no publications for EIF4E2 Antibody (H00009470-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF4E2 Antibody (H00009470-M02) (0)

There are no reviews for EIF4E2 Antibody (H00009470-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EIF4E2 Antibody (H00009470-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EIF4E2 Products

Bioinformatics Tool for EIF4E2 Antibody (H00009470-M02)

Discover related pathways, diseases and genes to EIF4E2 Antibody (H00009470-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIF4E2 Antibody (H00009470-M02)

Discover more about diseases related to EIF4E2 Antibody (H00009470-M02).
 

Pathways for EIF4E2 Antibody (H00009470-M02)

View related products by pathway.

PTMs for EIF4E2 Antibody (H00009470-M02)

Learn more about PTMs related to EIF4E2 Antibody (H00009470-M02).
 

Research Areas for EIF4E2 Antibody (H00009470-M02)

Find related products by research area.

Blogs on EIF4E2

There are no specific blogs for EIF4E2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EIF4E2 Antibody (1A11) and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF4E2
Entrez
OMIM
Uniprot