New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Home » EED » EED Proteins » EED Recombinant Protein Antigen

EED Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for EED Protein (NBP2-38907PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

EED Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EED.

Source: E.coli

Amino Acid Sequence: HPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLK
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EED
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38907.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for EED Recombinant Protein Antigen

  • EED
  • embryonic ectoderm development
  • HEED
  • polycomb protein EED
  • WAIT1
  • WAIT1
  • WAIT-1
  • WD protein associating with integrin cytoplasmic tails 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NHS Antibody (6D9)
H00004810-M05
ELISA: NHS Antibody (6D9) [H00004810-M05] - Detection limit for recombinant GST tagged NHS is 0.03 ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: NHS Antibody (6D9) [H00004810-M05] - Analysis of monoclonal antibody to NHS on HeLa cell. Antibody concentration 10 ug/ml
Species: Hu
Applications: ELISA, ICC/IF, WB
EZH2/KMT6 Antibody
(CL11915)
NBP3-15125
Immunohistochemistry-Paraffin: EZH2/KMT6 Antibody (CL11915) [NBP3-15125] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: EZH2/KMT6 Antibody (CL11915) [NBP3-15125] - Staining of human glioblastoma multiforme shows strong nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: EZH2/KMT6 Antibody (CL11915) [NBP3-15125] - Staining of human kidney shows mainly absence of positivity in cells in tubules as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Histone H3
[Trimethyl Lys9] Anti ...
NBP1-30141
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Observed molecular weight is ~15 kDa.
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Representative Western blot showing M-track protein protein proximity signals obtained for Kic1. Hog1-protA-H3: background control, Nup2: positive control. Below: Proximity signals. n = 3 replicates per sample except when indicated differently. Ratios are log2-transformed. Black lines indicate average proximity signal. Proximity signals that differ significantly from background are marked in green (q 0.01) filled circles. Grey filled triangles: q > 0.05. N: N-terminal HKMTmyc fusion. Image collected and cropped by CiteAb from the following publication (https://biosignaling.biomedcentral.com/articles/10.1186/s12964-019-0381-z), licensed under a CC-BY licence.
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Analysis of Histone H3 K9-me3 in HeLa histone lysates. Observed molecular weight is ~15 kDa.
(2 Reviews)
(23 Publications)
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
SUZ12 Antibody
(448909) [Unconjugate
MAB4184
SUZ12 was immunoprecipitated from 400 µg of HeLa human cervical epithelial carcinoma cell line lysates using 4 µg of Mouse Anti-Human/Mouse SUZ12 Monoclonal Antibody (Catalog # MAB4184) coated on 4 wells of a 96 well plate (Corning Costar EIA/RIA). HeLa lysates or control buffer were added to the wells and incubated for 2 hours at room temperature. Immunoprecipitated SUZ12 was detected by Western blot under reducing conditions using 0.1 µg/mL Sheep Anti-Human SUZ12 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4184) and Immunoblot Buffer Group 1. View our recommended buffer recipes for Immunoprecipitation.
Western blot shows lysates of JEG‑3 human epithelial choriocarcinoma cell line. Gels were loaded with 40 µg of cytoplasmic (Cyto) and 20 µg of nuclear (Nuc) extracts. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse SUZ12 Monoclonal Antibody (Catalog # MAB4184) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for SUZ12 at approximately 90 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SUZ12 was detected in immersion fixed D3 mouse embryonic stem cell line using Mouse Anti-Human/Mouse SUZ12 Monoclonal Antibody (Catalog # MAB4184) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
(1 Publication)
Species: Hu, Mu
Applications: ICC, IP, WB
BMI-1 Antibody
(LLBmi1-1) - BSA Free
NBP1-96140
Flow Cytometry: BMI-1 Antibody (LLBmi1-1) [NBP1-96140] - An intracellular stain was performed on U2OS cells with BMI-1 Antibody [LLBmi1-1] NBP1-96140AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow Cytometry: BMI-1 Antibody (LLBmi1-1) [NBP1-96140] - An intracellular stain was performed on U2OS cells with BMI-1 [LLBmi1-1] Antibody NBP1-96140 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1.0 ug/mL for 30 minutes at room temperature, followed by Mouse IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550 (84540, Thermo Fisher).
Immunocytochemistry/Immunofluorescence: BMI-1 Antibody (LLBmi1-1) [NBP1-96140] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti- NBP1-96140 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ChIP, Flow-IC, Flow, ICC/IF, IP, WB
RNF2 Antibody (6C2)
H00006045-M01
Western Blot: RNF2 Antibody (6C2) [H00006045-M01] - Analysis of RNF2 expression in transfected 293T cell line by RNF2 monoclonal antibody (M01), clone 6C2.Lane 1: RNF2 transfected lysate(37.7 KDa).Lane 2: Non-transfected lysate.
Western Blot: RNF2 Antibody (6C2) [H00006045-M01] - Analysis of RNF2 over-expressed 293 cell line, cotransfected with RNF2 Validated Chimera RNAi ( Cat # H00006045-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RNF2 monoclonal antibody (M01), clone 6C2 (Cat # H00006045-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Sandwich ELISA: RNF2 Antibody (6C2) [H00006045-M01] - Detection limit for recombinant GST tagged RNF2 is approximately 0.03ng/ml as a capture antibody.
(4 Publications)
Species: Hu, I, Mu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
PRC1 Antibody
NBP1-88856
Immunohistochemistry-Paraffin: PRC1 Antibody [NBP1-88856] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: PRC1 Antibody [NBP1-88856] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: PRC1 Antibody [NBP1-88856] - Staining in human testis and pancreas tissues.. Corresponding PRC1 RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
RING1 Antibody
NBP1-80830
Immunocytochemistry/Immunofluorescence: RING1 Antibody [NBP1-80830] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Western Blot: RING1 Antibody [NBP1-80830] - Analysis in control (vector only transfected HEK293T lysate) and RING1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: RING1 Antibody [NBP1-80830] - Staining of human Cerebral cortex shows strong nuclear positivity in neuronal and glial cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p19ARF/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(1 Review)
(45 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAN1C1 Antibody
NBP2-14217
Immunohistochemistry-Paraffin: MAN1C1 Antibody [NBP2-14217] - Staining of human Kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: MAN1C1 Antibody [NBP2-14217] - Staining of human Testis shows strong granular cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: MAN1C1 Antibody [NBP2-14217] - Staining of human Skeletal muscle shows no positivity in myocytes as expected.
Species: Hu
Applications: IHC, IHC-P
YY1 Antibody
NBP2-20932
Western Blot: YY1 Antibody [NBP2-20932] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with YY1 antibody diluted at 1:2000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: YY1 Antibody [NBP2-20932] - YY1 antibody detects YY1 protein at nucleus by immunofluorescent analysis. Sample: HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: YY1 stained by YY1 antibody diluted at 1:1000. Red: phalloidin, a cytoskeleton marker, diluted at 1:200. Scale bar= 10 um.
Western Blot: YY1 Antibody [NBP2-20932] - Sample (30 ug of whole cell lysate) A: NIH-3T3 10% SDS PAGE gel, diluted at 1:2000.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CEACAM5/CD66e
Antibody (CEA31) - Az ...
NBP2-34594
Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free [NBP2-34594] - Human Colon Carcinoma stained with CEACAM5/CD66e Antibody (CEA31).
Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free [NBP2-34594] - Human Colon Carcinoma stained with CEACAM5/CD66e Antibody (CEA31).
Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free [NBP2-34594] - Human colon stained with CEA MAb (CEA31)
(2 Reviews)
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
CEACAM7 Antibody
[Unconjugated]
AF4478
CEACAM‑7 was detected in immersion fixed paraffin-embedded sections of human colon cancer tissue using Sheep Anti-Human CEACAM‑7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4478) at 3 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to cell surfaces of cancer cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of LNCaP human prostate cancer cell line, HeLa human cervical epithelial carcinoma cell line and human liver tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human CEACAM‑7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4478) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for CEACAM‑7 at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
(1 Review)
Species: Hu
Applications: IHC, WB
Recombinant Human
PSG2 GST (N-Term) Pro ...
H00005670-Q01
SDS-Page: Recombinant Human PSG2 Protein [H00005670-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Band 3 Antibody
NBP2-49409
Immunohistochemistry: Band 3 Antibody [NBP2-49409] - Staining of human spleen shows strong positivity in erythrocytes.
Immunohistochemistry-Paraffin: Band 3 Antibody [NBP2-49409] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: Band 3 Antibody [NBP2-49409] - Staining in human bone marrow and cerebral cortex tissues using anti-SLC4A1 antibody. Corresponding SLC4A1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
EZH1 Antibody
NB100-56358
Western Blot: EZH1 Antibody [NB100-56358] - Detection of EZH1 in mouse (lane 1) and human (lane 2) spleen lysate using this antibody at 2 ug/mL.
Western Blot: EZH1 Antibody [NB100-56358] - 15 ug of HeLa nuclear extract on PVDF membrane. Image from verified customer.
Western Blot: EZH1 Antibody [NB100-56358] - WB detection of EZH1 protein in (A ) Ramos cells lysate, (B) Daudi cells lysate and (C) Peptide blocked - Daudi cells lysate by using EZH1 antibody at a concentration of 2 ug/mL.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB

Publications for EED Protein (NBP2-38907PEP) (0)

There are no publications for EED Protein (NBP2-38907PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EED Protein (NBP2-38907PEP) (0)

There are no reviews for EED Protein (NBP2-38907PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EED Protein (NBP2-38907PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EED Products

Bioinformatics Tool for EED Protein (NBP2-38907PEP)

Discover related pathways, diseases and genes to EED Protein (NBP2-38907PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EED Protein (NBP2-38907PEP)

Discover more about diseases related to EED Protein (NBP2-38907PEP).
 

Pathways for EED Protein (NBP2-38907PEP)

View related products by pathway.

PTMs for EED Protein (NBP2-38907PEP)

Learn more about PTMs related to EED Protein (NBP2-38907PEP).

Blogs on EED.

Check out the latest blog posts on EED.
Microglia: pruning shears for homeostatic maintenance in the brain
By Jennifer Sokolowski, MD, PhD.Microglia play a critical role in pruning neurons and synapses during homeostatic maintenance in the adult brain.1 A recent study by Ayata et al. (2018) identified regional differe...  Read full blog post.
EZH1 has more to offer than gene repression
EZH1 is part of the Polycomb-group family of proteins, which are responsible for remodeling chromatin in genes and modulating epigenetic silencing during development.  Specifically, EZHI is a component of PRC2, or polycomb repressive complex-2.  PR...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EED Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol EED