Home » EED » EED Proteins » EED Recombinant Protein Antigen

EED Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for EED Protein (NBP2-38907PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

EED Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EED.

Source: E.coli

Amino Acid Sequence: HPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLK
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EED
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38907.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for EED Recombinant Protein Antigen

  • EED
  • embryonic ectoderm development
  • HEED
  • polycomb protein EED
  • WAIT1
  • WAIT1
  • WAIT-1
  • WD protein associating with integrin cytoplasmic tails 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NHS Antibody (6D9)
H00004810-M05
Immunocytochemistry/Immunofluorescence: NHS Antibody (6D9) [H00004810-M05] - Analysis of monoclonal antibody to NHS on HeLa cell. Antibody concentration 10 ug/ml
ELISA: NHS Antibody (6D9) [H00004810-M05] - Detection limit for recombinant GST tagged NHS is 0.03 ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
EZH2/KMT6 Antibody
NB110-83976
Western Blot: KMT6/EZH2 Antibody [NB110-83976] - Detection of E2H2 in Jurkat whole cell lysate using NB110-83976.
(1 Review)
Species: Hu, Mu, Pm
Applications: WB
Histone H3
[Trimethyl Lys9] Anti ...
NBP1-30141
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Observed molecular weight is ~15 kDa.
Immunohistochemistry-Paraffin: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Histone 3 was detected in immersion fixed paraffin-embedded sections of human colon cancer using anti-human mouse monoclonal antibody (Catalog # NBP1-30141) at 1:1000 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
Immunocytochemistry/Immunofluorescence: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton X-100. The cells were incubated with anti-Histone H3 [Trymethyl Lys9] (6F12-H4) at 2 ug/ml overnight at 4C and detected with an anti-mouse DyLight 488 (green) at a 1:500 dilution. Nuclei were counterstained with DAPI (blue). Cells were imaged using a 40X objective.
(1 Review)
(18 Publications)
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
SUZ12 Antibody
NBP3-03738
Western Blot: SUZ12 Antibody [NBP3-03738] - Analysis of extracts from normal (control) and SUZ12 knockout (KO) HeLa cells, using SUZ12 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.
Immunocytochemistry/Immunofluorescence: SUZ12 Antibody [NBP3-03738] - Analysis of C6 cells using SUZ12 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: SUZ12 Antibody [NBP3-03738] - Paraffin-embedded mouse brain using SUZ12 antibody at dilution of 1:100 (40x lens).
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
BMI-1 Antibody
(LLBmi1-1)
NBP1-96140
Western Blot: BMI-1 Antibody (LLBmi1-1) [NBP1-96140] - BMI-1 expression in human cell lines (MCF-7, K562 and A459). Image from verified customer review.
Immunocytochemistry/Immunofluorescence: Bmi1 Antibody (LLBmi1-1) [NBP1-96140] - Bmi1 antibody was tested in U2OS cells with FITC (green). Nuclei and alpha-tubulin were counterstained with Dapi (blue) and Dylight 550 (red).
Flow Cytometry: BMI-1 Antibody (LLBmi1-1) [NBP1-96140] - An intracellular stain was performed on U2OS cells with BMI-1 [LLBmi1-1] Antibody NBP1-96140 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1.0 ug/mL for 30 minutes at room temperature, followed by Mouse IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550 (84540, Thermo Fisher).
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IP, Flow-IC
RNF2 Antibody (6C2)
H00006045-M01
Western Blot: RNF2 Antibody (6C2) [H00006045-M01] - RNF2 monoclonal antibody (M01), clone 6C2 Analysis of RNF2 expression in NIH/3T3.
Western Blot: RNF2 Antibody (6C2) [H00006045-M01] - Analysis of RNF2 over-expressed 293 cell line, cotransfected with RNF2 Validated Chimera RNAi ( Cat # H00006045-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RNF2 monoclonal antibody (M01), clone 6C2 (Cat # H00006045-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot: RNF2 Antibody (6C2) [H00006045-M01] - RNF2 monoclonal antibody (M01), clone 6C2. Analysis of RNF2 expression in Raw 264.7.
(4 Publications)
Species: Hu, Mu, I
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA
PRC1 Antibody
NBP1-88856
Western Blot: PRC1 Antibody [NBP1-88856] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: PRC1 Antibody [NBP1-88856] - Staining of human cerebral cortex shows moderate positivity in nuclear membrane in neurons.
Immunohistochemistry-Paraffin: PRC1 Antibody [NBP1-88856] - Staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
RING1 Antibody
(8C12F4)
NBP2-37370
Western Blot: RING1 Antibody (8C12F4) [NBP2-37370] - Analysis using Ring1 mouse mAb against MOLT-4 (1), LNCaP (2), Hela (3), HEK-293 (4) and Jurkat (5) cell lysate.
Immunohistochemistry-Paraffin: RING1 Antibody (8C12F4) [NBP2-37370] - Analysis of rectum cancer tissues using Ring1 mouse mAb with DAB staining.
Flow Cytometry: RING1 Antibody (8C12F4) [NBP2-37370] - Analysis of Hela cells using Ring1 mouse mAb (green) and negative control (red).
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
p19ARF/CDKN2A
Antibody
NB200-106
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p16INK4a/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
(1 Review)
(42 Publications)
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAN1C1 Antibody
NBP2-14217
Western Blot: MAN1C1 Antibody [NBP2-14217] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: MAN1C1 Antibody [NBP2-14217] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Species: Hu
Applications: WB, IHC, IHC-P
YY1 Antibody
NBP2-20932
Western Blot: YY1 Antibody [NBP2-20932] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with YY1 antibody diluted at 1:2000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: YY1 Antibody [NBP2-20932] - YY1 antibody detects YY1 protein at nucleus by immunofluorescent analysis. Sample: HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: YY1 stained by YY1 antibody diluted at 1:1000. Red: phalloidin, a cytoskeleton marker, diluted at 1:200. Scale bar= 10 um.
Immunohistochemistry-Paraffin: YY1 Antibody [NBP2-20932] - Immunohistochemical analysis of paraffin-embedded C2C12 xenograft, using antibody at 1:500 dilution.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
CEACAM5/CD66e
Antibody (CEA31) - Az ...
NBP2-34594
Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free [NBP2-34594] - Human Colon Carcinoma stained with CEACAM5/CD66e Antibody (CEA31).
Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free [NBP2-34594] - Human Colon Carcinoma stained with CEACAM5/CD66e Antibody (CEA31).
Immunohistochemistry-Paraffin: CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free [NBP2-34594] - Human Colon Carcinoma stained with CEACAM5/CD66e Antibody (CEA31).
(1 Review)
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
CEACAM7 Antibody
[Unconjugated]
AF4478
Western blot shows lysates of LNCaP human prostate cancer cell line, HeLa human cervical epithelial carcinoma cell line and human liver tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human CEACAM‑7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4478) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for CEACAM‑7 at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
CEACAM‑7 was detected in immersion fixed paraffin-embedded sections of human colon cancer tissue using Sheep Anti-Human CEACAM‑7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4478) at 3 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to cell surfaces of cancer cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC
Recombinant Human
PSG2 GST (N-Term) Pro ...
H00005670-Q01
SDS-Page: Recombinant Human PSG2 Protein [H00005670-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Band 3 Antibody
(BIII 136)
NB120-11012
Western Blot: Band 3 Antibody (BIII 136) [NB120-11012] - Human erythrocytes ghosts extract was separated on SDS-PAGE and probed with Monoclonal Anti-Band 3 Clone: BIII-136. The antibody was developed using Goat Anti-Mouse IgG-Peroxidase and AEC substrate.
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
EZH1 Antibody
NB100-56358
Western Blot: EZH1 Antibody [NB100-56358] - WB detection of EZH1 protein in (A ) Ramos cells lysate, (B) Daudi cells lysate and (C) Peptide blocked - Daudi cells lysate by using EZH1 antibody at a concentration of 2 ug/mL.
Western Blot: EZH1 Antibody [NB100-56358] - Detection of EZH1 in mouse (lane 1) and human (lane 2) spleen lysate using this antibody at 2 ug/mL.
Western Blot: EZH1 Antibody [NB100-56358] - 15 ug of HeLa nuclear extract on PVDF membrane. Image from verified customer.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB

Publications for EED Protein (NBP2-38907PEP) (0)

There are no publications for EED Protein (NBP2-38907PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EED Protein (NBP2-38907PEP) (0)

There are no reviews for EED Protein (NBP2-38907PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EED Protein (NBP2-38907PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional EED Products

Bioinformatics Tool for EED Protein (NBP2-38907PEP)

Discover related pathways, diseases and genes to EED Protein (NBP2-38907PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EED Protein (NBP2-38907PEP)

Discover more about diseases related to EED Protein (NBP2-38907PEP).
 

Pathways for EED Protein (NBP2-38907PEP)

View related products by pathway.

PTMs for EED Protein (NBP2-38907PEP)

Learn more about PTMs related to EED Protein (NBP2-38907PEP).

Blogs on EED.

Check out the latest blog posts on EED.
Microglia: pruning shears for homeostatic maintenance in the brain
By Jennifer Sokolowski, MD, PhD.Microglia play a critical role in pruning neurons and synapses during homeostatic maintenance in the adult brain.1 A recent study by Ayata et al. (2018) identified regional differe...  Read full blog post.
EZH1 has more to offer than gene repression
EZH1 is part of the Polycomb-group family of proteins, which are responsible for remodeling chromatin in genes and modulating epigenetic silencing during development.  Specifically, EZHI is a component of PRC2, or polycomb repressive complex-2.  PR...  Read full blog post.

Customers Who Bought This Also Bought

Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p16INK4a/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
p19ARF/CDKN2A Antibody
NB200-106
Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Observed molecular weight is ~15 kDa.
Histone H3 [Trimethyl Lys9] Antibody (6F12-H4)
NBP1-30141

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EED Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol EED