dynein, cytoplasmic 2, light intermediate chain 1 Antibody

Images

 
Western Blot: dynein, cytoplasmic 2, light intermediate chain 1 Antibody [NBP2-82947] - Host: Rabbit. Target Name: DYNC2LI1. Sample Tissue: Human Fetal Kidney. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity Hu, Rt, Ca, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

dynein, cytoplasmic 2, light intermediate chain 1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human dynein, cytoplasmic 2, light intermediate chain 1. Peptide sequence: LDRDEPPKPTLALEYTYGRRAKGHNTPKDIAHFWELGGGTSLLDLISIPI The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (100%), Canine (93%), Guinea Pig (100%), Rabbit (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
DYNC2LI1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for dynein, cytoplasmic 2, light intermediate chain 1 Antibody

  • CGI-60
  • cytoplasmic dynein 2 light intermediate chain 1
  • D2LICDKFZp564A033
  • DKFZP564A033
  • dynein, cytoplasmic 2, light intermediate chain 1
  • LIC3Dynein 2 light intermediate chain

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58497
Species: Hu
Applications: WB, ICC/IF
NBP1-94086
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-25151
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF
H00004218-M02
Species: Hu, Mu, Ze
Applications: WB, ELISA, ICC/IF
NBP1-84880
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24535
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, Single-Cell Western
NBP2-46524
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC
NBP2-16927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74389
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-195
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-48967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-27497
Species: Hu
Applications: WB, PEP-ELISA
NBP1-80207
Species: Hu
Applications: WB
NBP1-52654
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
AF2400
Species: Hu
Applications: WB, IHC, ChIP, ICC

Publications for dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-82947) (0)

There are no publications for dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-82947).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-82947) (0)

There are no reviews for dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-82947). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-82947) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional dynein, cytoplasmic 2, light intermediate chain 1 Products

Bioinformatics Tool for dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-82947)

Discover related pathways, diseases and genes to dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-82947). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on dynein, cytoplasmic 2, light intermediate chain 1

There are no specific blogs for dynein, cytoplasmic 2, light intermediate chain 1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our dynein, cytoplasmic 2, light intermediate chain 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DYNC2LI1