dynein, cytoplasmic 2, light intermediate chain 1 Antibody


Western Blot: dynein, cytoplasmic 2, light intermediate chain 1 Antibody [NBP2-82945] - Host: Rabbit. Target Name: DYNC2LI1. Sample Tissue: Human Hela Whole Cell. Antibody Dilution: 1ug/ml

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

dynein, cytoplasmic 2, light intermediate chain 1 Antibody Summary

The immunogen is a synthetic peptide directed towards the C-terminal region of Human dynein, cytoplasmic 2, light intermediate chain 1. Peptide sequence: SPMELWKKVYEKLFPPKSINTLKDIKDPARDPQYAENEVDEMRIQKDLEL The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for dynein, cytoplasmic 2, light intermediate chain 1 Antibody

  • CGI-60
  • cytoplasmic dynein 2 light intermediate chain 1
  • D2LICDKFZp564A033
  • DKFZP564A033
  • dynein, cytoplasmic 2, light intermediate chain 1
  • LIC3Dynein 2 light intermediate chain


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Ze
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, Simple Western, Single-Cell Western, WB
Species: Hu
Applications: BA
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: PEP-ELISA, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ChIP, ICC, IHC, WB

Publications for dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-82945) (0)

There are no publications for dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-82945).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-82945) (0)

There are no reviews for dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-82945). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-82945) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional dynein, cytoplasmic 2, light intermediate chain 1 Products

Bioinformatics Tool for dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-82945)

Discover related pathways, diseases and genes to dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-82945). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-82945)

Find related products by research area.

Blogs on dynein, cytoplasmic 2, light intermediate chain 1

There are no specific blogs for dynein, cytoplasmic 2, light intermediate chain 1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our dynein, cytoplasmic 2, light intermediate chain 1 Antibody and receive a gift card or discount.


Gene Symbol DYNC2LI1