We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human DUSP11 GST (N-Term) Protein

Images

 
Recombinant Human DUSP11 Protein [H00008446-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human DUSP11 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 221-330 of Human DUSP11

Source: Wheat Germ (in vitro)

Amino Acid Sequence: SAHLMQPVHNKPVKQGPRYNLHQIQGHSAPRHFHTQTQSLQQSVRKFSENPHVYQRHHLPPPGPPGEDYSHRRYSWNVKPNASRAAQDRRRWYPYNYSRLSYPACWEWTQ

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
DUSP11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DUSP11 GST (N-Term) Protein

  • dual specificity phosphatase 11 (RNA/RNP complex 1-interacting)
  • Dual specificity protein phosphatase 11
  • EC 3.1.3.-
  • Phosphatase that interacts with RNA/RNP complex 1
  • PIR1RNA/RNP complex-interacting phosphatase
  • RNA/RNP complex-1-interacting phosphatase
  • serine/threonine specific protein phosphatase

Background

The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product is localized to the nucleus, and is novel in that it binds directly to RNA and splicing factors, and thus suggested to participate in nuclear mRNA metabolism. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19840
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02128
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-19491
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, WB
NBP3-15005
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB110-68133
Species: Hu
Applications: IHC,  IHC-P, WB
202-IL
Species: Hu
Applications: BA
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
MAB4457
Species: Hu, Mu, Rt
Applications: WB
NBP3-03514
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP1-81162
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00051531-B01P
Species: Hu, Rt
Applications: ICC/IF, WB
NBP2-24727
Species: Ca, Hu, Mu
Applications: ICC/IF, WB
MAB1654
Species: Hu, Mu, Rt
Applications: WB

Publications for DUSP11 Partial Recombinant Protein (H00008446-Q01) (0)

There are no publications for DUSP11 Partial Recombinant Protein (H00008446-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DUSP11 Partial Recombinant Protein (H00008446-Q01) (0)

There are no reviews for DUSP11 Partial Recombinant Protein (H00008446-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DUSP11 Partial Recombinant Protein (H00008446-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DUSP11 Products

Blogs on DUSP11

There are no specific blogs for DUSP11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DUSP11 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DUSP11