DPP9 Antibody

Immunocytochemistry/Immunofluorescence: DPP9 Antibody [NBP1-89492] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.

Immunohistochemistry-Paraffin: DPP9 Antibody [NBP1-89492] - Staining of human tonsil shows moderate cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: DPP9 Antibody [NBP1-89492] - Staining of human heart muscle shows weak cytoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: DPP9 Antibody [NBP1-89492] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Product Discontinued

DPP9 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RDGKYAWAMFLDRPQQWLQLVLLPPALFIPSTENEEQRLASARAVPRNVQPYVVYEEVTNVWINVHDIFYPFPQSEGEDELCFL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DPP9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DPP9 Antibody

• dipeptidyl peptidase 9
• Dipeptidyl peptidase IV-related protein 2
• dipeptidyl peptidase IV-related protein-2
• Dipeptidyl peptidase IX
• Dipeptidyl peptidase-like protein 9
• dipeptidylpeptidase 9
• dipeptidyl-peptidase 9
• DKFZp762F117
• DP9
• DPLP9
• DPP IX
• DPP9
• DPRP2
• DPRP-2
• EC 3.4.14.5
• FLJ16073

Background

DPP9 encodes a protein that is a member of the S9B family in clan SC of the serine proteases. The protein has been shown to have post-proline dipeptidyl aminopeptidase activity, cleaving Xaa-Pro dipeptides from the N-termini of proteins. Although the activity of this protein is similar to that of dipeptidyl peptidase 4 (DPP4), it does not appear to be membrane bound. In general, dipeptidyl peptidases appear to be involved in the regulation of the activity of their substrates and have been linked to a variety of diseases including type 2 diabetes, obesity and cancer. Several transcript variants of this gene have been described but not fully characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DPP9