DPP9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DPP9 Antibody [NBP1-89492] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: DPP9 Antibody [NBP1-89492] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DPP9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RDGKYAWAMFLDRPQQWLQLVLLPPALFIPSTENEEQRLASARAVPRNVQPYVVYEEVTNVWINVHDIFYPFPQSEGEDELCFL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DPP9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DPP9 Protein (NBP1-89492PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DPP9 Antibody

  • dipeptidyl peptidase 9
  • Dipeptidyl peptidase IV-related protein 2
  • dipeptidyl peptidase IV-related protein-2
  • Dipeptidyl peptidase IX
  • Dipeptidyl peptidase-like protein 9
  • dipeptidylpeptidase 9
  • dipeptidyl-peptidase 9
  • DKFZp762F117
  • DP9
  • DPLP9
  • DPP IX
  • DPP9
  • DPRP2
  • DPRP-2
  • EC 3.4.14.5
  • FLJ16073

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-84993
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002191-M01
Species: Hu
Applications: WB, ELISA, IP
NBP2-16669
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84986
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
46780002
Species: Hu
Applications: ELISA
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01249
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for DPP9 Antibody (NBP1-89492) (0)

There are no publications for DPP9 Antibody (NBP1-89492).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPP9 Antibody (NBP1-89492) (0)

There are no reviews for DPP9 Antibody (NBP1-89492). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DPP9 Antibody (NBP1-89492) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DPP9 Products

Bioinformatics Tool for DPP9 Antibody (NBP1-89492)

Discover related pathways, diseases and genes to DPP9 Antibody (NBP1-89492). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPP9 Antibody (NBP1-89492)

Discover more about diseases related to DPP9 Antibody (NBP1-89492).
 

Pathways for DPP9 Antibody (NBP1-89492)

View related products by pathway.

PTMs for DPP9 Antibody (NBP1-89492)

Learn more about PTMs related to DPP9 Antibody (NBP1-89492).
 

Research Areas for DPP9 Antibody (NBP1-89492)

Find related products by research area.

Blogs on DPP9

There are no specific blogs for DPP9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DPP9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DPP9
Entrez