DOPEY1 Antibody

Immunocytochemistry/Immunofluorescence: DOPEY1 Antibody [NBP1-90582] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: DOPEY1 Antibody [NBP1-90582] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: DOPEY1 Antibody [NBP1-90582] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: DOPEY1 Antibody [NBP1-90582] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: DOPEY1 Antibody [NBP1-90582] - Staining of human rectum shows weak cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: DOPEY1 Antibody [NBP1-90582] - Staining of human stomach shows weak cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Rt
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

DOPEY1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KLETDCEHVQPPQWLQTLMNACSQASDFSVQSVAISLVMDLVGLTQSVAMVTGENINSVEPAQPLSPNQGRVAVVIRPPLTQGNL
• Predicted Species: Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DOPEY1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DOPEY1 Protein (NBP1-90582PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DOPEY1 Antibody

• dopey family member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DOPEY1