Recombinant Human DOK5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DOK5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 130-198 of Human DOK5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LQSVKNSMLQMKMSERAASLSTMVPLPRSAYWQHITRQHSTGQLYRLQDVSSPLKLHRTETFPAYRSEH

Protein/Peptide Type
Partial Recombinant Protein
Gene
DOK5

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DOK5 Protein

  • C20orf180
  • chromosome 20 open reading frame 180
  • dJ805C22.1
  • docking protein 5
  • Downstream of tyrosine kinase 5
  • Insulin receptor substrate 6
  • IRS6
  • IRS-6
  • MGC16926

Background

DOK5 - docking protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33274
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-82112
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
H00000420-B01P
Species: Hu
Applications: WB
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-14130
Species: Hu
Applications: IHC, IHC-P
MAB7008
Species: Hu
Applications: WB, ICC
AF5094
Species: Hu, Mu, Rt
Applications: WB
AF6347
Species: Hu
Applications: WB
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF482
Species: Mu
Applications: WB, IHC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00055816-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for DOK5 Partial Recombinant Protein (H00055816-Q01) (0)

There are no publications for DOK5 Partial Recombinant Protein (H00055816-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DOK5 Partial Recombinant Protein (H00055816-Q01) (0)

There are no reviews for DOK5 Partial Recombinant Protein (H00055816-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DOK5 Partial Recombinant Protein (H00055816-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DOK5 Products

Bioinformatics Tool for DOK5 Partial Recombinant Protein (H00055816-Q01)

Discover related pathways, diseases and genes to DOK5 Partial Recombinant Protein (H00055816-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DOK5 Partial Recombinant Protein (H00055816-Q01)

Discover more about diseases related to DOK5 Partial Recombinant Protein (H00055816-Q01).
 

Pathways for DOK5 Partial Recombinant Protein (H00055816-Q01)

View related products by pathway.

PTMs for DOK5 Partial Recombinant Protein (H00055816-Q01)

Learn more about PTMs related to DOK5 Partial Recombinant Protein (H00055816-Q01).

Blogs on DOK5

There are no specific blogs for DOK5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DOK5 Antibody
NB100-1463
FOXO3 Antibody
NBP2-16521

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DOK5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DOK5