Recombinant Human DHRSX Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DHRSX Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 330 of Human DHRSX full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDLYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYAAVTPELEGVGGRYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGVLDVTL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
DHRSX

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DHRSX Protein

  • CXorf11
  • dehydrogenase/reductase (SDR family) X chromosome
  • dehydrogenase/reductase (SDR family) X-linked
  • DHRS5Xmember 1
  • EC 1.1
  • SDR46C1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83631
Species: Hu
Applications: IHC, IHC-P
MAB6130
Species: Mu
Applications: Flow, CyTOF-ready, ICC, Neut
MAB6117
Species: Hu
Applications: WB, IHC
NBP1-80669
Species: Hu
Applications: IHC, IHC-P
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NBP1-85808
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46442
Species: Hu
Applications: WB, IHC
DDX0300P-100
Species: Hu, Ca
Applications: Flow, IHC, IHC-Fr, IHC-P, IP
NBP2-49382
Species: Hu
Applications: IHC
H00008653-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-68135
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
AF5735
Species: Hu
Applications: WB
NBP2-46383
Species: Hu
Applications: WB, Flow, IHC
H00207063-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for DHRSX Recombinant Protein (H00207063-P01) (0)

There are no publications for DHRSX Recombinant Protein (H00207063-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DHRSX Recombinant Protein (H00207063-P01) (0)

There are no reviews for DHRSX Recombinant Protein (H00207063-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DHRSX Recombinant Protein (H00207063-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DHRSX Products

Bioinformatics Tool for DHRSX Recombinant Protein (H00207063-P01)

Discover related pathways, diseases and genes to DHRSX Recombinant Protein (H00207063-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DHRSX Recombinant Protein (H00207063-P01)

Discover more about diseases related to DHRSX Recombinant Protein (H00207063-P01).
 

Pathways for DHRSX Recombinant Protein (H00207063-P01)

View related products by pathway.

Research Areas for DHRSX Recombinant Protein (H00207063-P01)

Find related products by research area.

Blogs on DHRSX

There are no specific blogs for DHRSX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DHRSX Antibody
NBP1-85219

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DHRSX Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DHRSX