DHRSX Antibody

Images

 
Western Blot: DHRSX Antibody [NBP2-87269] - WB Suggested Anti-DHRSX Antibody. Titration: 1.0 ug/ml. Positive Control: THP-1 Whole Cell

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DHRSX Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of DHRSX. Peptide sequence: GFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAK The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
DHRSX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DHRSX Antibody

  • CXorf11
  • dehydrogenase/reductase (SDR family) X chromosome
  • dehydrogenase/reductase (SDR family) X-linked
  • DHRS5Xmember 1
  • EC 1.1
  • SDR46C1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008225-P01
Species: Hu
Applications: ELISA, AP, PA, WB
MAB6130
Species: Mu
Applications: CyTOF-ready, Flow, ICC, Neut
MAB6117
Species: Hu
Applications: IHC, WB
H00023471-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
MAB943
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
NBL1-10172
Species: Hu
Applications: WB
NBP2-46442
Species: Hu
Applications: IHC, WB
DDX0300P-100
Species: Ca, Hu
Applications: Flow, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-49382
Species: Hu
Applications: IHC, IHC-P
NBP3-16963
Species: Hu
Applications: ELISA, ICC/IF, IHC-P, WB
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
AF4629
Species: Hu
Applications: WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
AF5735
Species: Hu
Applications: WB
NBP2-71419
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-87269
Species: Hu
Applications: WB

Publications for DHRSX Antibody (NBP2-87269) (0)

There are no publications for DHRSX Antibody (NBP2-87269).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DHRSX Antibody (NBP2-87269) (0)

There are no reviews for DHRSX Antibody (NBP2-87269). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DHRSX Antibody (NBP2-87269) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DHRSX Products

Bioinformatics Tool for DHRSX Antibody (NBP2-87269)

Discover related pathways, diseases and genes to DHRSX Antibody (NBP2-87269). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DHRSX Antibody (NBP2-87269)

Discover more about diseases related to DHRSX Antibody (NBP2-87269).
 

Pathways for DHRSX Antibody (NBP2-87269)

View related products by pathway.

Research Areas for DHRSX Antibody (NBP2-87269)

Find related products by research area.

Blogs on DHRSX

There are no specific blogs for DHRSX, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DHRSX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DHRSX