DHRS7B Antibody


Western Blot: DHRS7B Antibody [NBP1-62572] - HT1080 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

DHRS7B Antibody Summary

Synthetic peptides corresponding to DHRS7B(dehydrogenase/reductase (SDR family) member 7B) The peptide sequence was selected form the middle region of DHRS7B. Peptide sequence QAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
This is a rabbit polyclonal antibody against DHRS7B and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for DHRS7B Antibody

  • CGI-93
  • dehydrogenase/reductase (SDR family) member 7B
  • dehydrogenase/reductase SDR family member 7B
  • DKFZp566O084
  • EC 1.1
  • MGC8916
  • SDR32C1
  • short chain dehydrogenase/reductase family 32C, member 1


This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for DHRS7B Antibody (NBP1-62572) (0)

There are no publications for DHRS7B Antibody (NBP1-62572).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DHRS7B Antibody (NBP1-62572) (0)

There are no reviews for DHRS7B Antibody (NBP1-62572). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DHRS7B Antibody (NBP1-62572) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for DHRS7B Antibody (NBP1-62572)

Discover related pathways, diseases and genes to DHRS7B Antibody (NBP1-62572). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for DHRS7B Antibody (NBP1-62572)

View related products by pathway.

Research Areas for DHRS7B Antibody (NBP1-62572)

Find related products by research area.

Blogs on DHRS7B

There are no specific blogs for DHRS7B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DHRS7B Antibody and receive a gift card or discount.


Gene Symbol DHRS7B