DDX51 Antibody - BSA Free

Western Blot: DDX51 Antibody [NBP2-87264] - Host: Rabbit. Target Name: DDX51. Sample Tissue: Human MCF7 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Discontinued

DDX51 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DDX51. Peptide sequence: EQESLVQKTADGYRCLADIVVATPGRLVDHIDQTPGFSLQQLRFLIIDEA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DDX51
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DDX51 Antibody - BSA Free

• ATP-dependent RNA helicase DDX51
• DEAD (Asp-Glu-Ala-Asp) box polypeptide 51
• DEAD box protein 51
• DKFZp686N2081
• EC 3.6.1
• EC 3.6.4.13
• MGC42193

Background

DDX51 is a member of the DEAD box family of proteins that possesses several conserved motifs which include the highly conserved DEAD (Asp-Glu-Ala-Asp) amino acid sequence motif. The major activity of DEAD box proteins is to function as ATP-dependent RNA helicases. As helicases, DEAD proteins play an important role in all aspects of RNA metabolism and function which include pre-mRNA splicing, RNA synthesis, RNA degradation, RNA export, RNA translation, RNA secondary structure formation, ribosome biogenesis, and the assembly of RNP complexes. DDX51 may function in biogenesis of the 60S ribosomal subunit. Alternate names for DDX51 include ATP-dependent RNA helicase DDX51, DEAD box protein 51, MGC42193, and DKFZp686N2081.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DDX51