DDX28 Antibody

Immunocytochemistry/Immunofluorescence: DDX28 Antibody [NBP2-58209] - Staining of human cell line U-2 OS shows localization to mitochondria.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

DDX28 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VAELVHILKHRDRAERTGPSGTVLVFCNSSSTVNWLGYILDDHKIQHLRLQGQMPALMRVGIFQSFQKSSRDILLCTDIASRGLDSTGV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DDX28
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DDX28 Recombinant Protein Antigen (NBP2-58209PEP)

Reactivity Notes

Mouse 81%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DDX28 Antibody

• DEAD (Asp-Glu-Ala-Asp) box polypeptide 28
• DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 28
• EC 3.6.1
• EC 3.6.4.13
• FLJ11282
• M
• MDDX28probable ATP-dependent RNA helicase DDX28
• Mitochondrial DEAD box protein 28
• mitochondrial DEAD-box polypeptide 28

Background

DDX28, also known as Probable ATP-dependent RNA helicase DDX28, is a 59.6 kDa, 540 amino acid protein that is utilized in RNA processing and transport as a member of the DEAD box protein family. The protein is currently being studied for its involvement in prostatitis. As a part of the RNA binding pathway, the protein interacts with AARS2, ACAD9, ABCB7, ICT1, and AASS proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DDX28