DDX28 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DDX28 Antibody [NBP2-58209] - Staining of human cell line U-2 OS shows localization to mitochondria.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DDX28 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VAELVHILKHRDRAERTGPSGTVLVFCNSSSTVNWLGYILDDHKIQHLRLQGQMPALMRVGIFQSFQKSSRDILLCTDIASRGLDSTGV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DDX28
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DDX28 Recombinant Protein Antigen (NBP2-58209PEP)

Reactivity Notes

Mouse 81%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for DDX28 Antibody

  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 28
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 28
  • EC 3.6.1
  • EC 3.6.4.13
  • FLJ11282
  • M
  • MDDX28probable ATP-dependent RNA helicase DDX28
  • Mitochondrial DEAD box protein 28
  • mitochondrial DEAD-box polypeptide 28

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-93867
Species: Hu, Mu, Rt
Applications: WB
H00051428-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NBP2-19561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-87976
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for DDX28 Antibody (NBP2-58209) (0)

There are no publications for DDX28 Antibody (NBP2-58209).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX28 Antibody (NBP2-58209) (0)

There are no reviews for DDX28 Antibody (NBP2-58209). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DDX28 Antibody (NBP2-58209) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DDX28 Products

Bioinformatics Tool for DDX28 Antibody (NBP2-58209)

Discover related pathways, diseases and genes to DDX28 Antibody (NBP2-58209). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDX28 Antibody (NBP2-58209)

Discover more about diseases related to DDX28 Antibody (NBP2-58209).
 

Pathways for DDX28 Antibody (NBP2-58209)

View related products by pathway.

Blogs on DDX28

There are no specific blogs for DDX28, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDX28 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX28