DDX28 Antibody - BSA Free

Western Blot: DDX28 Antibody [NBP1-83757] - Analysis in control (vector only transfected HEK293T lysate) and DDX28 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: DDX28 Antibody [NBP1-83757] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.

Immunohistochemistry-Paraffin: DDX28 Antibody [NBP1-83757] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DDX28 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TLLDESFLELVDYILEKSHIAEGPADLEDPFNPKAQLVLVGATFPEGVGQLLNKVASPDAVTTITSSKLHCIMPHVKQTFLRLKGADK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DDX28
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DDX28 Protein (NBP1-83757PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DDX28 Antibody - BSA Free

• DEAD (Asp-Glu-Ala-Asp) box polypeptide 28
• DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 28
• EC 3.6.1
• EC 3.6.4.13
• FLJ11282
• M
• MDDX28probable ATP-dependent RNA helicase DDX28
• Mitochondrial DEAD box protein 28
• mitochondrial DEAD-box polypeptide 28

Background

DDX28, also known as Probable ATP-dependent RNA helicase DDX28, is a 59.6 kDa, 540 amino acid protein that is utilized in RNA processing and transport as a member of the DEAD box protein family. The protein is currently being studied for its involvement in prostatitis. As a part of the RNA binding pathway, the protein interacts with AARS2, ACAD9, ABCB7, ICT1, and AASS proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DDX28