We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

DCAF4 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: DCAF4 Antibody [NBP1-91820] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: DCAF4 Antibody [NBP1-91820] - Staining of human uterus, pre-menopause shows strong cytoplasmic positivity in glandular cells.
Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.
Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

DCAF4 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TSSGTAGTSSVPELPGFYFDPEKKRYFRLLPGHNNCNPLTKESIRQKEMESKRLRLLQEEDRRK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DCAF4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DCAF4 Protein (NBP1-91820PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for DCAF4 Antibody - BSA Free

  • DDB1 and CUL4 associated factor 4
  • DDB1- and CUL4-associated factor 4
  • DKFZp434K114
  • MGC20547
  • MGC46524
  • WD repeat domain 21
  • WD repeat domain 21A
  • WD repeat-containing protein 21A
  • WDR21
  • WDR21A

Background

DCAF4 encodes a WD repeat-containing protein. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-23927
Species: Hu
Applications:  IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: EM, IHC,  IHC-P, WB
NB100-56434
Species: Ca, Hu, Mu, Rt
Applications: WB

Publications for DCAF4 Antibody (NBP1-91820) (0)

There are no publications for DCAF4 Antibody (NBP1-91820).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DCAF4 Antibody (NBP1-91820) (0)

There are no reviews for DCAF4 Antibody (NBP1-91820). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DCAF4 Antibody (NBP1-91820) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DCAF4 Products

Research Areas for DCAF4 Antibody (NBP1-91820)

Find related products by research area.

Blogs on DCAF4

There are no specific blogs for DCAF4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DCAF4 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol DCAF4