Recombinant Human DAPP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DAPP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-108 of Human DAPP1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
DAPP1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DAPP1 Protein

  • B lymphocyte adapter protein Bam32
  • BAM32
  • BAM32DKFZp667E0716
  • B-cell adapter molecule of 32 kDa
  • DAPP1
  • dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide
  • dual adaptor of phosphotyrosine and 3-phosphoinositides
  • hDAPP1

Background

DAPP1 - dual adaptor of phosphotyrosine and 3-phosphoinositides

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-86967
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-519
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP1-90655
Species: Hu
Applications: IHC, IHC-P
MAB2317
Species: Hu, Mu, Rt
Applications: WB, ICC
H00027071-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for DAPP1 Partial Recombinant Protein (H00027071-Q01) (0)

There are no publications for DAPP1 Partial Recombinant Protein (H00027071-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAPP1 Partial Recombinant Protein (H00027071-Q01) (0)

There are no reviews for DAPP1 Partial Recombinant Protein (H00027071-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DAPP1 Partial Recombinant Protein (H00027071-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DAPP1 Products

Bioinformatics Tool for DAPP1 Partial Recombinant Protein (H00027071-Q01)

Discover related pathways, diseases and genes to DAPP1 Partial Recombinant Protein (H00027071-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DAPP1 Partial Recombinant Protein (H00027071-Q01)

Discover more about diseases related to DAPP1 Partial Recombinant Protein (H00027071-Q01).
 

Pathways for DAPP1 Partial Recombinant Protein (H00027071-Q01)

View related products by pathway.

PTMs for DAPP1 Partial Recombinant Protein (H00027071-Q01)

Learn more about PTMs related to DAPP1 Partial Recombinant Protein (H00027071-Q01).
 

Research Areas for DAPP1 Partial Recombinant Protein (H00027071-Q01)

Find related products by research area.

Blogs on DAPP1

There are no specific blogs for DAPP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DAPP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DAPP1
Entrez