![Immunohistochemistry-Paraffin: DAPL1 Antibody [NBP2-14582] - Staining of human placenta shows low expression as expected.](http://images.novusbio.com/fullsize/DAPL1-Antibody-Immunohistochemistry-Paraffin-NBP2-14582-img0005.jpg "Immunohistochemistry-Paraffin: DAPL1 Antibody [NBP2-14582] - Staining of human placenta shows low expression as expected.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit DAPL1 Antibody - BSA Free (NBP2-14582) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: AGGMRISKKQEIGTLERHTKKTGFEKTSAIANVAKIQTLDALNDTLEKLNYKFPATVHMAHQKPTPALEKVVPLKRIYIIQQP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DAPL1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DAPL1 |
![Immunohistochemistry-Paraffin: DAPL1 Antibody [NBP2-14582] - Staining of human epididymis shows high expression.](http://images.novusbio.com/fullsize/DAPL1-Antibody-Immunohistochemistry-Paraffin-NBP2-14582-img0003.jpg "Immunohistochemistry-Paraffin: DAPL1 Antibody [NBP2-14582] - Staining of human epididymis shows high expression.")
![Immunohistochemistry-Paraffin: DAPL1 Antibody [NBP2-14582] - Staining of human hair shows strong positivity in cortex layer.](http://images.novusbio.com/fullsize/DAPL1-Antibody-Immunohistochemistry-Paraffin-NBP2-14582-img0004.jpg "Immunohistochemistry-Paraffin: DAPL1 Antibody [NBP2-14582] - Staining of human hair shows strong positivity in cortex layer.")
![Immunohistochemistry-Paraffin: DAPL1 Antibody [NBP2-14582] - Staining in human epididymis and placenta tissues using anti-DAPL1 antibody. Corresponding DAPL1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/DAPL1-Antibody-Immunohistochemistry-Paraffin-NBP2-14582-img0006.jpg "Immunohistochemistry-Paraffin: DAPL1 Antibody [NBP2-14582] - Staining in human epididymis and placenta tissues using anti-DAPL1 antibody. Corresponding DAPL1 RNA-seq data are presented for the same tissues.")
![Simple Western Aldo-keto Reductase 1C1/AKR1C1 Antibody (859026) [Unconjugated]](https://images.novusbio.com/images2/Aldoketo_Reductase_1C1_MAB6529_Simple_Western_17147.jpg)
![Western Blot Aldo-keto Reductase 1C1/AKR1C1 Antibody (859026) [Unconjugated]](https://images.novusbio.com/images2/Aldoketo_Reductase_1C1_MAB6529_Western_Blot_13068.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")