Cytokeratin 71 Antibody

Product Discontinued

Cytokeratin 71 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: EFPSPVSISIISSTSGGSGYGFRPSMVSGGYVANSSNCISGVCSVRGGEGRSRGSANDYKDTLGKGSSLSAPSKKTSR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KRT71
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Expected species cross reactivity based on sequence identity (not validated): Mouse (83%), Rat (43%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Cytokeratin 71 Antibody

• CK-71
• cytokeratin-71
• hK6irs
• hK6irs1
• K6IRS1MGC119390
• K71
• KB34
• Keratin 6 irs
• keratin 71
• keratin, type II cytoskeletal 71
• keratin-71
• KRT6IRS
• KRT6IRS1MGC119391
• Type II inner root sheath-specific keratin-K6irs1
• Type-II keratin Kb34

Background

K6IRS1 belongs to a family of type II keratins that are specifically expressed in the inner root sheath of hair follicles.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KRT71