We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Cyclin G2 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related Cyclin G2 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-87518PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Cyclin G2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CCNG2.

Source: E. coli

Amino Acid Sequence: PSVLALCLLNLEVETLKSVELLEILLLVKKHSKINDTEFFYWRELVSKCLAEYSSPECCKPDLKKLVWIVSRRTAQNLHNSYYSVPELPTIPEGGCFDESES

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CCNG2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87518.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cyclin G2 Recombinant Protein Antigen

  • cyclin G2
  • cyclin-G2

Background

The eukaryotic cell cycle is governed by cyclin-dependent protein kinases (CDKs) whose activities are regulated by cyclins and CDK inhibitors. The 8 species of cyclins reported in mammals, cyclins A through H, share a conserved amino acid sequence of about 90 residues called the cyclin box. The amino acid sequence of cyclin G is well conserved among mammals. The nucleotide sequence of cyclin G1 and cyclin G2 are 53% identical. Unlike cyclin G1, cyclin G2 contains a C-terminal PEST protein destabilization motif, suggesting that cyclin G2 expression is tightly regulated through the cell cycle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92649
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-16521
Species: Hu, Mu, Rt, Sq, Xp
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF4654
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
MAB77491
Species: Hu
Applications: CyTOF-ready, Flow
NBP1-82455
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
AF6897
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NBP3-13225
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38206
Species: Hu
Applications: IHC,  IHC-P, KD, WB
NBP3-38210
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-31308
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP3-48071
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-45269
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P

Publications for Cyclin G2 Protein (NBP1-87518PEP) (0)

There are no publications for Cyclin G2 Protein (NBP1-87518PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cyclin G2 Protein (NBP1-87518PEP) (0)

There are no reviews for Cyclin G2 Protein (NBP1-87518PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cyclin G2 Protein (NBP1-87518PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cyclin G2 Products

Research Areas for Cyclin G2 Protein (NBP1-87518PEP)

Find related products by research area.

Blogs on Cyclin G2

There are no specific blogs for Cyclin G2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cyclin G2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CCNG2