CWH43 Antibody

Images

 
Immunohistochemistry: CWH43 Antibody [NBP2-30438] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CWH43 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GNVKDIDSTDHDRWCEYIMYRGLIRLGYARISHAELSDSEIQMAKFRIPDDPTNYRDNQKVVIDHREVSEKIHFNPRFGSYKEGHNYENNHHFHMNTPKYF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CWH43
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CWH43 Protein (NBP2-30438PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CWH43 Antibody

  • Cell Wall Biogenesis 43 C-Terminal Homolog (S. Cerevisiae)
  • Cell Wall Biogenesis Protein 43 C-Terminal Homolog
  • CWH43-C
  • PGAP2-Interacting Protein
  • PGAP2IP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31867
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NB100-57495
Species: Hu
Applications: WB, IP, PLA
NBP2-43782
Species: Hu
Applications: WB
AF4736
Species: Hu
Applications: WB
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NBP1-86791
Species: Hu
Applications: IHC, IHC-P
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38121
Species: Hu
Applications: IHC, IHC-P

Publications for CWH43 Antibody (NBP2-30438) (0)

There are no publications for CWH43 Antibody (NBP2-30438).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CWH43 Antibody (NBP2-30438) (0)

There are no reviews for CWH43 Antibody (NBP2-30438). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CWH43 Antibody (NBP2-30438) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CWH43 Products

CWH43 NBP2-30438

Bioinformatics Tool for CWH43 Antibody (NBP2-30438)

Discover related pathways, diseases and genes to CWH43 Antibody (NBP2-30438). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CWH43 Antibody (NBP2-30438)

Discover more about diseases related to CWH43 Antibody (NBP2-30438).
 

Pathways for CWH43 Antibody (NBP2-30438)

View related products by pathway.

PTMs for CWH43 Antibody (NBP2-30438)

Learn more about PTMs related to CWH43 Antibody (NBP2-30438).

Blogs on CWH43

There are no specific blogs for CWH43, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CWH43 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CWH43
Uniprot