CPEB2 Antibody

Western Blot: CPEB2 Antibody [NBP2-56392] - Analysis in human testis tissue.

Immunocytochemistry/Immunofluorescence: CPEB2 Antibody [NBP2-56392] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Product Discontinued

CPEB2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NTLLPLQVRSSLQLPAWGSDSLQDSWCTAAGTSRIDQDRSRMYDSLNMHS
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CPEB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CPEB2 Antibody

• CPEB-2
• CPE-binding protein 2
• CPE-BP2
• cytoplasmic polyadenylation element binding protein 2
• cytoplasmic polyadenylation element-binding protein 2
• hCPEB-2
• MGC119575
• MGC119576
• MGC119577

Background

The protein encoded by the CPEB2 gene is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), anmRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis andspermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionallyinactive haploid spermatids. Alternatively spliced transcript variants encoding distinct isoforms have been described.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CPEB2