Coronin-2B Antibody - Azide and BSA Free

Western Blot: Coronin-2B Antibody [H00010391-B01P] - Analysis of CORO2B expression in A-431.

Western Blot: Coronin-2B Antibody [H00010391-B01P] - Analysis of CORO2B expression in transfected 293T cell line by CORO2B polyclonal antibody. Lane 1: CORO2B transfected lysate(52.25 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Coronin-2B Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse Coronin-2B Antibody - Azide and BSA Free (H00010391-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: CORO2B (AAH26335.1, 1 a.a. - 475 a.a.) full-length human protein. MSWRPQYRSSKFRNVYGKVANREHCFDGIPITKNVHDNHFCAVNTRFLAIVTESAGGGSFLVIPLEQTGRIEPNYPKVCGHQGNVLDIKWNPFIDNIIASCSEDTSVRIWEIPEGGLKRNMTEALLELHGHSRRVGLVEWHPTTNNILFSAGYDYKVLIWNLDVGEPVKMIDCHTDVILCMSFNTDGSLLTTTCKDKKLRVIEPRSGRVLQEANCKNHRVNRVVFLGNMKRLVTTGVSRWNTRQIALWDQEDLSMPLIEEEIDGLSGLLFPFYDADTHMLYLAGKGDGNIRYYEISTEKPYLSYLMEFRSPAPQKGLGVMPKHGLDVSACEVFRFYKLVTLKGLIEPISMIVPRRSDSYQEDIYPMTPGTEPALTPDEWLGGINRDPVLMSLKEGYKKSSKMVFKAPIKEKKSVVVNGIDLLENVPPRTENELLRMFFRQQDEIRRLKEELAQKDIRIRQLQLELKNLRNSPKNC
• Specificity: CORO2B - coronin, actin binding protein, 2B,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: CORO2B
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Coronin-2B Antibody - Azide and BSA Free

• clipin C
• CLIPINC
• Clipin-C
• coronin, actin binding protein, 2B
• coronin, actin-binding protein, 2B
• coronin, actin-binding, 2B
• coronin-2B
• Coronin-like protein C
• KIAA0925clipin-C
• Protein FC96

Background

Research results indicate that ClipinC is a component part of the cross bridge between the actin cytoskeleton and the plasma membrane. These findings and the previously reported function of coronin suggest that ClipinC may play specific roles in the reorganization of neuronal actin structure, a change that has been implicated in both cell motility and growth cone advance.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CORO2B
• Entrez:
  • 10391(Human)
• Uniprot:
  • AAH26335.1(Human)