CoREST3/RCOR3 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: RSRTSLMDRQARKLANRHNQGDSDDDVEETHPMDGNDSDYDPKKEAKKEGNTEQPVQTSKIGLGRREYQSLQHRHHSQRSKCRPPKGMYLTQEDVVAVSCSPNAANT |
| Predicted Species |
Mouse (96%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RCOR3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 0.04-0.4 ug/ml
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for CoREST3/RCOR3 Antibody - BSA Free
Background
RCOR3 is a member of the coREST family that functions as a co-repressor for REST (RE1-silencing transcription factor) to regulate neuronal gene expression and neuronal stem cell fate. The coREST family includes RCOR1, also known as coREST, RCOR2, and RCOR3. REST complexes regulate gene expression by modifying chromatin to create a repressive epigenetic environment. Alternate names for RCOR3 include KIAA1343, FLJ10876, FLJ16298, and RP11-318L16.1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, IHC, IHC-P, IP, WB
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: WB
Publications for CoREST3/RCOR3 Antibody (NBP3-17822) (0)
There are no publications for CoREST3/RCOR3 Antibody (NBP3-17822).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CoREST3/RCOR3 Antibody (NBP3-17822) (0)
There are no reviews for CoREST3/RCOR3 Antibody (NBP3-17822).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CoREST3/RCOR3 Antibody (NBP3-17822) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CoREST3/RCOR3 Products
Blogs on CoREST3/RCOR3